Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BVG8-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-22 (9) CEAELQELR PA
4
23-42 (20) TKPAGPCPGCEHSQESAQLR PA
4
45-56 (12) LSQLQLEMAESK PA
4
57-69 (13) GMLSELNLEVQQK PA
4
100-109 (10) DSHETIASLR PA
4
121-128 (8) TVEVESSK PA
4
131-139 (9) QALSESQAR PA
4
140-151 (12) NQHLQEQVAMQR PA
4
156-170 (15) EMEQQLQSSHQLTAR PA
4
173-184 (12) AQIAMYESELER PA
4
185-200 (16) AHGQMLEEMQSLEEDK PA
4
203-210 (8) AIEEAFAR PA
4
217-226 (10) AVHENLAGVR PA
4
227-237 (11) TNLLTLQPALR PA
4
238-247 (10) TLTNDYNGLK PA
4
252-262 (11) GFPLLLQEALR PA
4
266-284 (19) AEIGQAIEEVNSNNQELLR PA
4
319-345 (27) EDGEGPEATNAVTFDADDDSIIHLLHK PA
4
346-355 (10) GKPVSFELDK PA
4
356-395 (40) VFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGK PA
4
396-411 (16) TYTMEGTAENPGINQR PA
4
412-423 (12) ALQLLFSEVQEK PA
4
424-444 (21) ASDWEYTITVSAAEIYNEVLR PA
4
459-485 (27) LCPDGSGQLYVPGLTEFQVQSVDDINK PA
4
486-494 (9) VFEFGHTNR PA
3
495-507 (13) TTEFTNLNEHSSR PA
3
508-517 (10) SHALLIVTVR PA
3
518-526 (9) GVDCSTGLR PA
3
531-541 (11) LNLVDLAGSER PA
7
561-573 (13) SLSALGDVIAALR PA
3
586-599 (14) LTYLLQDSLSGDSK PA
3
600-611 (12) TLMVVQVSPVEK PA
3
612-621 (10) NTSETLYSLK PA
3
628-636 (9) SVELGPGLR PA
3
638-663 (26) AELGSWSSQEHLEWEPACQTPQPSAR PA
3
664-680 (17) AHSAPSSGTSSRPGSIR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center