Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BVG8-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-27 (20) DTAAWCPEEAAEPQAMVPSR PA
0
29-39 (11) TWNLGATPSLR PA
3
47-76 (30) APEPEPGMARPAPAPASPAARPFPHTGPGR PA
3
84-96 (13) DTPVCGDEDSSAR PA
3
97-107 (11) SAARPALAQCR PA
3
108-132 (25) ALSVDWAGPGSPHGLYLTLQVEHLK PA
3
135-144 (10) LISQAQEVSR PA
3
147-156 (10) SELGGTDLEK PA
3
159-167 (9) DLLMVENER PA
3
175-183 (9) CEAELQELR PA
4
184-203 (20) TKPAGPCPGCEHSQESAQLR PA
4
206-217 (12) LSQLQLEMAESK PA
4
218-230 (13) GMLSELNLEVQQK PA
4
261-270 (10) DSHETIASLR PA
4
282-289 (8) TVEVESSK PA
4
292-300 (9) QALSESQAR PA
4
301-312 (12) NQHLQEQVAMQR PA
4
317-331 (15) EMEQQLQSSHQLTAR PA
4
334-345 (12) AQIAMYESELER PA
4
346-361 (16) AHGQMLEEMQSLEEDK PA
4
364-371 (8) AIEEAFAR PA
4
378-387 (10) AVHENLAGVR PA
4
388-398 (11) TNLLTLQPALR PA
4
399-408 (10) TLTNDYNGLK PA
4
413-423 (11) GFPLLLQEALR PA
4
427-445 (19) AEIGQAIEEVNSNNQELLR PA
4
480-506 (27) EDGEGPEATNAVTFDADDDSIIHLLHK PA
4
507-516 (10) GKPVSFELDK PA
4
517-556 (40) VFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGK PA
4
557-572 (16) TYTMEGTAENPGINQR PA
4
573-584 (12) ALQLLFSEVQEK PA
4
585-605 (21) ASDWEYTITVSAAEIYNEVLR PA
4
620-646 (27) LCPDGSGQLYVPGLTEFQVQSVDDINK PA
4
647-655 (9) VFEFGHTNR PA
3
656-668 (13) TTEFTNLNEHSSR PA
3
669-678 (10) SHALLIVTVR PA
3
679-687 (9) GVDCSTGLR PA
3
692-702 (11) LNLVDLAGSER PA
7
722-734 (13) SLSALGDVIAALR PA
3
747-760 (14) LTYLLQDSLSGDSK PA
3
761-772 (12) TLMVVQVSPVEK PA
3
773-782 (10) NTSETLYSLK PA
3
789-797 (9) SVELGPGLR PA
3
799-824 (26) AELGSWSSQEHLEWEPACQTPQPSAR PA
3
825-841 (17) AHSAPSSGTSSRPGSIR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center