Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BX51-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MTSEFFSAQLR PA
0
12-63 (52) AQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSK PA
0
66-103 (38) SPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGK PA
0
104-122 (19) QPLSSMCPTIMVGQDGQVR PA
2
123-152 (30) MVVGAAGGTQITMATALAIIYNLWFGYDVK PA
0
160-173 (14) LHNQLLPNVTTVER PA
3
174-186 (13) NIDQEVTAALETR PA
0
187-205 (19) HHHTQITSTFIAVVQAIVR PA
0
206-217 (12) MAGGWAAASDSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center