Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BXM0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-39 (26) AELVEIIVETEAQTGVSGINVAGGGK PA
1
56-69 (14) SLSLQEGDQLLSAR PA
1
83-91 (9) LLQCAEPYK PA
1
99-118 (20) TVPTGDLALRPGTVSGYEIK PA
1
127-136 (10) LNIQSLSPVK PA
0
140-162 (23) MVPGALGVPADLAPVDVEFSFPK PA
1
177-185 (9) GPVPAAPAR PA
1
197-206 (10) EVAEEAQAAR PA
1
207-215 (9) LAAAAPPPR PA
1
219-228 (10) VEAEVAAGAR PA
1
229-240 (12) FTAPQVELVGPR PA
1
241-255 (15) LPGAEVGVPQVSAPK PA
1
256-315 (60) AAPSAEAAGGFALHLPTLGLGAPAPPAVEAPAVGIQVPQVELPALPSLPTLPTLPCLETR PA
1
316-347 (32) EGAVSVVVPTLDVAAPTVGVDLALPGAEVEAR PA
1
348-356 (9) GEAPEVALK PA
1
393-414 (22) MPTFGLSLLEPRPAAPEVVESK PA
1
422-435 (14) MPSLGIGVSGPEVK PA
1
455-464 (10) VPEAALPEVR PA
1
465-472 (8) LPEVELPK PA
1
481-490 (10) VPEMAVPEVR PA
1
491-498 (8) LPEVELPK PA
1
507-516 (10) VPEMAVPEVR PA
1
517-524 (8) LPEVQLLK PA
1
533-542 (10) VPEMAVPEVR PA
1
543-550 (8) LPEVQLPK PA
1
556-568 (13) LPEVSEVAVPEVR PA
1
569-576 (8) LPEVQLPK PA
1
600-607 (8) LPEVQLPK PA
1
608-625 (18) VPEMAVPDVHLPEVQLPK PA
1
644-661 (18) VPEMAVPDVHLPEVQLPK PA
1
670-679 (10) MPEMAVPEVR PA
1
680-687 (8) LPEVQLPK PA
1
696-713 (18) VPEMAVPDVHLPEVQLPK PA
1
732-749 (18) VPEMAVPDVHLPEVQLPK PA
1
755-762 (8) LPEMQVPK PA
1
763-770 (8) VPDVHLPK PA
1
789-800 (12) AEQAEGMEFGFK PA
1
818-830 (13) GKPGEAGAEVSGK PA
1
831-875 (45) LVTLPCLQPEVDGEAHVGVPSLTLPSVELDLPGALGLQGQVPAAK PA
1
882-892 (11) VEGPEVAAGVR PA
1
898-917 (20) VPSVEIVTPQLPAVEIEEGR PA
1
946-953 (8) AEAEGAGR PA
1
971-978 (8) VGAEAEAK PA
1
979-1006 (28) GAGEAGLLPALDLSIPQLSLDAHLPSGK PA
1
1007-1015 (9) VEVAGADLK PA
1
1032-1048 (17) DTEAAELVPGVAELEGK PA
1
1063-1070 (8) MPSFGLAR PA
1
1073-1080 (8) EAEVQGDR PA
1
1087-1095 (9) AESTAVQLK PA
1
1096-1111 (16) IPEVELVTLGAQEEGR PA
1
1112-1127 (16) AEGAVAVSGMQLSGLK PA
1
1128-1144 (17) VSTAGQVVTEGHDAGLR PA
1
1145-1184 (40) MPPLGISLPQVELTGFGEAGTPGQQAQSTVPSAEGTAGYR PA
1
1185-1212 (28) VQVPQVTLSLPGAQVAGGELLVGEGVFK PA
1
1213-1229 (17) MPTVTVPQLELDVGLSR PA
1
1230-1244 (15) EAQAGEAATGEGGLR PA
1
1256-1270 (15) VGGEGAEEQPPGAER PA
1
1271-1303 (33) TFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHK PA
1
1318-1325 (8) EGAEEGEK PA
1
1336-1370 (35) VGFSQSEMVTGEGSPSPEEEEEEEEEGSGEGASGR PA
1
1381-1388 (8) VGLAAPSK PA
1
1392-1400 (9) GQEGDAAPK PA
1
1423-1434 (12) SGSGDQEEGGLR PA
1
1437-1452 (16) LPSVGFSETGAPGPAR PA
1
1453-1461 (9) MEGAQAAAV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center