Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BXM0-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MVPGALGVPADLAPVDVEFSFPK PA
1
38-46 (9) GPVPAAPAR PA
1
58-67 (10) EVAEEAQAAR PA
1
68-76 (9) LAAAAPPPR PA
1
80-89 (10) VEAEVAAGAR PA
1
90-101 (12) FTAPQVELVGPR PA
1
102-116 (15) LPGAEVGVPQVSAPK PA
1
117-176 (60) AAPSAEAAGGFALHLPTLGLGAPAPPAVEAPAVGIQVPQVELPALPSLPTLPTLPCLETR PA
1
177-208 (32) EGAVSVVVPTLDVAAPTVGVDLALPGAEVEAR PA
1
209-217 (9) GEAPEVALK PA
1
254-275 (22) MPTFGLSLLEPRPAAPEVVESK PA
1
283-296 (14) MPSLGIGVSGPEVK PA
1
316-325 (10) VPEAALPEVR PA
1
326-333 (8) LPEVELPK PA
1
342-351 (10) VPEMAVPEVR PA
1
352-359 (8) LPEVELPK PA
1
368-377 (10) VPEMAVPEVR PA
1
378-385 (8) LPEVQLLK PA
1
394-403 (10) VPEMAVPEVR PA
1
404-411 (8) LPEVQLPK PA
1
417-429 (13) LPEVSEVAVPEVR PA
1
430-437 (8) LPEVQLPK PA
1
461-468 (8) LPEVQLPK PA
1
469-486 (18) VPEMAVPDVHLPEVQLPK PA
1
505-522 (18) VPEMAVPDVHLPEVQLPK PA
1
531-540 (10) MPEMAVPEVR PA
1
541-548 (8) LPEVQLPK PA
1
557-574 (18) VPEMAVPDVHLPEVQLPK PA
1
593-610 (18) VPEMAVPDVHLPEVQLPK PA
1
616-623 (8) LPEMQVPK PA
1
624-631 (8) VPDVHLPK PA
1
650-661 (12) AEQAEGMEFGFK PA
1
679-691 (13) GKPGEAGAEVSGK PA
1
692-736 (45) LVTLPCLQPEVDGEAHVGVPSLTLPSVELDLPGALGLQGQVPAAK PA
1
743-753 (11) VEGPEVAAGVR PA
1
759-778 (20) VPSVEIVTPQLPAVEIEEGR PA
1
807-814 (8) AEAEGAGR PA
1
832-839 (8) VGAEAEAK PA
1
840-867 (28) GAGEAGLLPALDLSIPQLSLDAHLPSGK PA
1
868-876 (9) VEVAGADLK PA
1
893-909 (17) DTEAAELVPGVAELEGK PA
1
924-931 (8) MPSFGLAR PA
1
934-941 (8) EAEVQGDR PA
1
948-956 (9) AESTAVQLK PA
1
957-972 (16) IPEVELVTLGAQEEGR PA
1
973-988 (16) AEGAVAVSGMQLSGLK PA
1
989-1005 (17) VSTAGQVVTEGHDAGLR PA
1
1006-1045 (40) MPPLGISLPQVELTGFGEAGTPGQQAQSTVPSAEGTAGYR PA
1
1046-1073 (28) VQVPQVTLSLPGAQVAGGELLVGEGVFK PA
1
1074-1090 (17) MPTVTVPQLELDVGLSR PA
1
1091-1105 (15) EAQAGEAATGEGGLR PA
1
1117-1131 (15) VGGEGAEEQPPGAER PA
1
1132-1164 (33) TFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHK PA
1
1179-1186 (8) EGAEEGEK PA
1
1197-1231 (35) VGFSQSEMVTGEGSPSPEEEEEEEEEGSGEGASGR PA
1
1242-1249 (8) VGLAAPSK PA
1
1253-1261 (9) GQEGDAAPK PA
1
1284-1295 (12) SGSGDQEEGGLR PA
1
1298-1313 (16) LPSVGFSETGAPGPAR PA
1
1314-1322 (9) MEGAQAAAV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center