Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BXX2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-24 (11) GPEPPNPFSER PA
1
30-41 (12) DYGTIYFGDLGK PA
1
75-95 (21) TALHWACVNGHAEVVTFLVDR PA
1
97-107 (11) CQLNVLDGEGR PA
1
119-170 (52) EACANILIDAGADLNYVDVYGNTALHYAVYSENLLMVATLLSYGAVIEVQNK PA
1
171-182 (12) ASLTPLLLAIQK PA
1
186-194 (9) QTVEFLLTK PA
1
195-205 (11) NANANAFNESK PA
1
206-243 (38) CTALMLAICEGSSEIVGMLLQQNVDVFAEDIHGITAER PA
1
244-262 (19) YAAACGVNYIHQQLLEHIR PA
1
267-290 (24) NPQNTNPEGTSTGTPDEAAPLAER PA
1
291-301 (11) TPDTAESLLEK PA
1
309-316 (8) LVEGTSAK PA
1
328-337 (10) FEQSTEETPR PA
1
372-382 (11) TECVAGVTPNK PA
1
389-399 (11) GTSNMIACPTK PA
1
405-424 (20) ASTNVDVSSVEPIFSLFGTR PA
1
425-433 (9) TIENSQCTK PA
1
434-443 (10) VEEDFNLATK PA
1
448-463 (16) SAAQNYTCLPDATYQK PA
1
472-482 (11) IEDQMFPSESK PA
1
484-502 (19) EEDEEYSWDSGSLFESSAK PA
1
503-514 (12) TQVCIPESMYQK PA
1
521-540 (20) EVEELPEKPSAFKPAVEMQK PA
1
557-566 (10) AAQMFPSESK PA
1
569-587 (19) DDEENSWDSESPCETVSQK PA
1
599-606 (8) EFDTLSGK PA
1
614-623 (10) DGLLKPTCGR PA
0
648-657 (10) DGLLKPTCGR PA
0
676-691 (16) AESPDNDGLLKPTCGR PA
0
710-719 (10) AAQMFPSESK PA
1
722-746 (25) DDEENSWDFESFLETLLQNDVCLPK PA
0
752-759 (8) EFDTLSGK PA
1
767-777 (11) DGLLKPTCGMK PA
0
795-820 (26) AEDVSSVESTFSLFGKPTTENSQSTK PA
0
821-830 (10) VEEDFNLTTK PA
0
836-843 (8) TVTGQQER PA
0
851-858 (8) APQDQTNK PA
0
859-866 (8) MPTSELGR PA
0
872-897 (26) STSDSEIISVSDTQNYECLPEATYQK PA
0
906-929 (24) IEESPEKPSHFEPATEMQNSVPNK PA
0
941-948 (8) ADSTTLSK PA
0
949-958 (10) ILDALPSCER PA
0
965-973 (9) DNCEQITAK PA
0
1005-1013 (9) WEQELCSVR PA
1
1014-1022 (9) LTLNQEEEK PA
1
1033-1040 (8) IRPEEQLR PA
0
1047-1054 (8) QQLEQTLR PA
0
1062-1088 (27) SVTSNLNQVSHTHESENDLFHENCMLK PA
0
1123-1131 (9) NAELQMTLK PA
1
1150-1161 (12) VLTAENTMLTSK PA
0
1169-1181 (13) EILETEIESHHPR PA
0
1182-1196 (15) LASALQDHDQSVTSR PA
0
1198-1238 (41) NQELAFHSAGDAPLQGIMNVDVSNTIYNNEVLHQPLYEAQR PA
0
1245-1255 (11) INLNYAGDDLR PA
0
1256-1266 (11) ENALVSEHAQR PA
0
1269-1276 (8) CETQCQMK PA
0
1278-1291 (14) AEHMYQNEQDNVDK PA
0
1292-1302 (11) HTEQQESLEQK PA
0
1315-1322 (8) QQLVYAHK PA
0
1329-1339 (11) VTINIQFPEMK PA
0
1348-1359 (12) NEEVFNYGNHLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center