Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BXX2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-24 (11) GPEPPNPFSER PA
1
30-41 (12) DYGTIYFGDLGK PA
1
75-95 (21) TALHWACVNGHAEVVTFLVDR PA
1
97-107 (11) CQLNVLDGEGR PA
1
119-170 (52) EACANILIDAGADLNYVDVYGNTALHYAVYSENLLMVATLLSYGAVIEVQNK PA
1
171-182 (12) ASLTPLLLAIQK PA
1
186-194 (9) QTVEFLLTK PA
1
195-205 (11) NANANAFNESK PA
1
206-243 (38) CTALMLAICEGSSEIVGMLLQQNVDVFAEDIHGITAER PA
1
244-262 (19) YAAACGVNYIHQQLLEHIR PA
1
267-290 (24) NPQNTNPEGTSTGTPDEAAPLAER PA
1
291-301 (11) TPDTAESLLEK PA
1
309-316 (8) LVEGTSAK PA
1
328-337 (10) FEQSTEETPR PA
1
372-382 (11) TECVAGVTPNK PA
1
389-399 (11) GTSNMIACPTK PA
1
405-424 (20) ASTNVDVSSVEPIFSLFGTR PA
1
425-433 (9) TIENSQCTK PA
1
434-443 (10) VEEDFNLATK PA
1
448-463 (16) SAAQNYTCLPDATYQK PA
1
472-482 (11) IEDQMFPSESK PA
1
484-502 (19) EEDEEYSWDSGSLFESSAK PA
1
503-514 (12) TQVCIPESMYQK PA
1
521-540 (20) EVEELPEKPSAFKPAVEMQK PA
1
557-566 (10) AAQMFPSESK PA
1
569-587 (19) DDEENSWDSESPCETVSQK PA
1
599-606 (8) EFDTLSGK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center