Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BY21-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MGFNLTLAK PA
0
10-26 (17) LPNNELHGQESHNSGNR PA
0
33-71 (39) NTTLHNEFDTIVLPVLYLIIFVASILLNGLAVWIFFHIR PA
0
74-81 (8) TSFIFYLK PA
0
82-97 (16) NIVVADLIMTLTFPFR PA
0
98-110 (13) IVHDAGFGPWYFK PA
0
116-139 (24) YTSVLFYANMYTSIVFLGLISIDR PA
0
143-151 (9) VVKPFGDSR PA
0
152-159 (8) MYSITFTK PA
0
160-194 (35) VLSVCVWVIMAVLSLPNIILTNGQPTEDNIHDCSK PA
0
203-231 (29) WHTAVTYVNSCLFVAVLVILIGCYIAISR PA
0
239-246 (8) QFISQSSR PA
0
256-272 (17) VVVAVFFTCFLPYHLCR PA
0
273-282 (10) IPFTFSHLDR PA
0
283-290 (8) LLDESAQK PA
0
297-319 (23) EITLFLSACNVCLDPIIYFFMCR PA
0
351-358 (8) IYYDYTDV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center