Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BYG4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-22 (10) FYDCSAVEVK PA
1
48-82 (35) LVVHTHHISNSDVTIGYADVHGDLLPINNDDNFCK PA
1
83-92 (10) AVSSANPLLR PA
1
104-113 (10) GSLGAGSLCR PA
0
130-138 (9) AHLDIGLPR PA
0
139-157 (19) DFRPVSSIIDVDLVPETHR PA
0
164-175 (12) HGCEKPLGFYIR PA
0
182-189 (8) VTPHGLEK PA
1
190-197 (8) VPGIFISR PA
3
198-227 (30) MVPGGLAESTGLLAVNDEVLEVNGIEVAGK PA
0
228-253 (26) TLDQVTDMMIANSHNLIVTVKPANQR PA
0
262-283 (22) ALGSSGPPSDGTAGFVGPPAPR PA
0
284-325 (42) VLQNFHPDEAESDEDNDVVIEGTLEPARPPQTPGAPAGSLSR PA
0
326-334 (9) VNGAGLAQR PA
0
338-347 (10) DLALDGGLQR PA
0
358-376 (19) HSLALPPGGVEEHGPAVTL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center