Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BYL1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
28-39 (12) DVDATAHFSFCR PA
0
40-57 (18) TLLEHTVSAESIPCHLPR PA
0
58-69 (12) TPGTSLTWHDSR PA
0
73-80 (8) AASSRPIK PA
0
81-93 (13) LLQQPGTDTPQGR PA
0
94-125 (32) LYSDHYGLYHTSPSLGGLTRPVVLWSQQDVCK PA
0
130-150 (21) HCPHNYLVYVEAFSQHAITGR PA
0
163-171 (9) MGLAQEAQR PA
0
172-180 (9) QEVLQQVLR PA
0
189-200 (12) SLQLLSQASFGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center