Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BZ19-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-20 (9) AAAGAGGAR PA
0
21-30 (10) AAGPTGGASR PA
0
43-52 (10) AGAQGCGGPR PA
0
60-70 (11) ALPAQPLACAR PA
0
82-97 (16) AASALPDLAPDVFVLR PA
0
100-108 (9) LEETGEMFR PA
0
123-137 (15) EELDLMVGIPFNLQR PA
0
138-153 (16) LQYLDEGVLMDDTTLK PA
0
154-187 (34) FHDVVPGGIISLCIWHHDGWTELVLAAVEGDPSK PA
0
188-200 (13) LSCLGLTEDSFYR PA
0
201-211 (11) TANSEHFEGEK PA
0
220-230 (11) AFVALYVASHR PA
0
231-249 (19) GHFDAVQYLLEHGASCLSR PA
0
255-265 (11) TPLHVAAAMGR PA
0
266-282 (17) SDCIILLLQHGASIHDR PA
0
286-295 (10) GETPISIAHR PA
0
296-303 (8) LNHTLSER PA
0
318-325 (8) DLNDLVMK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center