Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BZ29-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MSQPPLLPASAETR PA
2
19-30 (12) ALSKPGTAAELR PA
2
31-38 (8) QSVSEVVR PA
2
39-47 (9) GSVLLAKPK PA
2
48-61 (14) LIEPLDYENVIVQK PA
4
63-71 (9) TQILNDCLR PA
4
72-87 (16) EMLLFPYDDFQTAILR PA
4
92-100 (9) YICSTVPAK PA
4
101-115 (15) AEEEAQSLFVTECIK PA
4
116-127 (12) TYNSDWHLVNYK PA
4
128-136 (9) YEDYSGEFR PA
4
148-161 (14) LPVHVYEVDEEVDK PA
4
162-172 (11) DEDAASLGSQK PA
4
184-195 (12) GNMNSAISVTMR PA
4
201-218 (18) FFHLIQLGDGSYNLNFYK PA
4
228-243 (16) GSIFLDSCMGVVQNNK PA
4
257-278 (22) SSYLLAADSEVEMEEWITILNK PA
4
279-291 (13) ILQLNFEAAMQEK PA
4
293-304 (12) NGDSHEDDEQSK PA
4
305-321 (17) LEGSGSGLDSYLPELAK PA
4
338-347 (10) LFYLDPDAQK PA
4
348-358 (11) LDFSSAEPEVK PA
4
372-407 (36) CNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIK PA
4
412-426 (15) ISADFHVDLNHFSVR PA
4
427-448 (22) QMLATTSPALMNGSGQSPSVLK PA
4
449-460 (12) GILHEAAMQYPK PA
4
461-478 (18) QGIFSVTCPHPDIFLVAR PA
4
482-496 (15) VLQGSITHCAEPYMK PA
4
523-530 (8) MPFAWAAR PA
4
535-542 (8) DASGNLDK PA
4
557-564 (8) LSNDDMLK PA
4
578-608 (31) LPVILGNLDITIDNVSSDFPNYVNSSYIPTK PA
4
616-631 (16) TPITFEVEEFVPCIPK PA
4
632-648 (17) HTQPYTIYTNHLYVYPK PA
4
663-671 (9) NIAICIEFK PA
4
672-682 (11) DSDEEDSQPLK PA
4
683-695 (13) CIYGRPGGPVFTR PA
4
696-715 (20) SAFAAVLHHHQNPEFYDEIK PA
4
716-725 (10) IELPTQLHEK PA
6
726-742 (17) HHLLLTFFHVSCDNSSK PA
4
749-764 (16) DVVETQVGYSWLPLLK PA
4
768-795 (28) VVTSEQHIPVSANLPSGYLGYQELGMGR PA
4
803-812 (10) WVDGGKPLLK PA
4
813-837 (25) ISTHLVSTVYTQDQHLHNFFQYCQK PA
4
838-851 (14) TESGAQALGNELVK PA
4
855-877 (23) SLHAMEGHVMIAFLPTILNQLFR PA
4
882-893 (12) ATQEEVAVNVTR PA
4
894-912 (19) VIIHVVAQCHEEGLESHLR PA
4
921-930 (10) AEPYVASEYK PA
4
931-938 (8) TVHEELTK PA
4
939-955 (17) SMTTILKPSADFLTSNK PA
4
959-969 (11) YSWFFFDVLIK PA
4
970-980 (11) SMAQHLIENSK PA
4
989-1011 (23) FPASYHHAVETVVNMLMPHITQK PA
4
1021-1031 (11) NANHSLAVFIK PA
4
1045-1059 (15) QINNYISCFAPGDPK PA
4
1071-1089 (19) VVCNHEHYIPLNLPMPFGK PA
4
1095-1110 (16) YQDLQLDYSLTDEFCR PA
4
1111-1120 (10) NHFLVGLLLR PA
4
1121-1130 (10) EVGTALQEFR PA
4
1134-1141 (8) LIAISVLK PA
4
1162-1179 (18) IATLYLPLFGLLIENVQR PA
4
1184-1197 (14) DVSPFPVNAGMTVK PA
4
1198-1214 (17) DESLALPAVNPLVTPQK PA
4
1215-1224 (10) GSTLDNSLHK PA
4
1225-1248 (24) DLLGAISGIASPYTTSTPNINSVR PA
3
1254-1268 (15) GSLISTDSGNSLPER PA
3
1279-1291 (13) HQQSSTLGNSVVR PA
3
1302-1312 (11) SLLMCFLYILK PA
3
1313-1325 (13) SMSDDALFTYWNK PA
3
1326-1350 (25) ASTSELMDFFTISEVCLHQFQYMGK PA
3
1363-1416 (54) LQQLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFK PA
2
1417-1430 (14) NQLLADHGHNPLMK PA
3
1432-1442 (11) VFDVYLCFLQK PA
3
1443-1450 (8) HQSETALK PA
3
1463-1471 (9) FPSTFYEGR PA
3
1472-1484 (13) ADMCAALCYEILK PA
3
1495-1506 (12) TEASQLLYFLMR PA
3
1507-1514 (8) NNFDYTGK PA
3
1520-1542 (23) THLQVIISVSQLIADVVGIGGTR PA
3
1543-1558 (16) FQQSLSIINNCANSDR PA
3
1562-1570 (9) HTSFSSDVK PA
3
1578-1587 (10) TVLMATAQMK PA
6
1588-1605 (18) EHENDPEMLVDLQYSLAK PA
3
1606-1614 (9) SYASTPELR PA
4
1616-1623 (8) TWLDSMAR PA
3
1628-1651 (24) NGDLSEAAMCYVHVTALVAEYLTR PA
3
1653-1671 (19) EAVQWEPPLLPHSHSACLR PA
3
1687-1727 (41) VITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWK PA
3
1731-1739 (9) YELIADIYK PA
3
1740-1747 (8) LIIPIYEK PA
3
1754-1763 (10) LAHLYDTLHR PA
3
1768-1776 (9) VTEVMHSGR PA
3
1785-1813 (29) VAFFGQAAQYQFTDSETDVEGFFEDEDGK PA
2
1822-1831 (10) LTPLSEISQR PA
3
1863-1878 (16) YAYIQVTHVIPFFDEK PA
3
1896-1907 (12) FMFEMPFTQTGK PA
3
1909-1917 (9) QGGVEEQCK PA
3
1920-1932 (13) TILTAIHCFPYVK PA
3
1935-1957 (23) IPVMYQHHTDLNPIEVAIDEMSK PA
3
1964-1975 (12) QLCSSAEVDMIK PA
3
1980-1997 (18) LQGSVSVQVNAGPLAYAR PA
3
1998-2006 (9) AFLDDTNTK PA
3
2022-2036 (15) QFVEACGQALAVNER PA
3
2040-2050 (11) EDQLEYQEEMK PA
3
2059-2069 (11) ELSEIMHEQLG PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center