Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BZ29-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-26 (11) ELVIESPLQYK PA
1
27-46 (20) DAAQGEVEAESPGPVPAKPK PA
1
47-60 (14) LIEPLDYENVIVQK PA
4
62-70 (9) TQILNDCLR PA
4
71-86 (16) EMLLFPYDDFQTAILR PA
4
91-99 (9) YICSTVPAK PA
4
100-114 (15) AEEEAQSLFVTECIK PA
4
115-126 (12) TYNSDWHLVNYK PA
4
127-135 (9) YEDYSGEFR PA
4
147-160 (14) LPVHVYEVDEEVDK PA
4
161-171 (11) DEDAASLGSQK PA
4
183-194 (12) GNMNSAISVTMR PA
4
200-217 (18) FFHLIQLGDGSYNLNFYK PA
4
227-242 (16) GSIFLDSCMGVVQNNK PA
4
256-277 (22) SSYLLAADSEVEMEEWITILNK PA
4
278-290 (13) ILQLNFEAAMQEK PA
4
292-303 (12) NGDSHEDDEQSK PA
4
304-320 (17) LEGSGSGLDSYLPELAK PA
4
337-346 (10) LFYLDPDAQK PA
4
347-357 (11) LDFSSAEPEVK PA
4
371-406 (36) CNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIK PA
4
411-425 (15) ISADFHVDLNHFSVR PA
4
426-447 (22) QMLATTSPALMNGSGQSPSVLK PA
4
448-459 (12) GILHEAAMQYPK PA
4
460-477 (18) QGIFSVTCPHPDIFLVAR PA
4
481-495 (15) VLQGSITHCAEPYMK PA
4
522-529 (8) MPFAWAAR PA
4
534-541 (8) DASGNLDK PA
4
556-563 (8) LSNDDMLK PA
4
577-607 (31) LPVILGNLDITIDNVSSDFPNYVNSSYIPTK PA
4
615-630 (16) TPITFEVEEFVPCIPK PA
4
631-647 (17) HTQPYTIYTNHLYVYPK PA
4
662-670 (9) NIAICIEFK PA
4
671-681 (11) DSDEEDSQPLK PA
4
682-694 (13) CIYGRPGGPVFTR PA
4
695-714 (20) SAFAAVLHHHQNPEFYDEIK PA
4
715-724 (10) IELPTQLHEK PA
6
725-741 (17) HHLLLTFFHVSCDNSSK PA
4
748-763 (16) DVVETQVGYSWLPLLK PA
4
767-794 (28) VVTSEQHIPVSANLPSGYLGYQELGMGR PA
4
802-811 (10) WVDGGKPLLK PA
4
812-836 (25) ISTHLVSTVYTQDQHLHNFFQYCQK PA
4
837-850 (14) TESGAQALGNELVK PA
4
854-876 (23) SLHAMEGHVMIAFLPTILNQLFR PA
4
881-892 (12) ATQEEVAVNVTR PA
4
893-911 (19) VIIHVVAQCHEEGLESHLR PA
4
920-929 (10) AEPYVASEYK PA
4
930-937 (8) TVHEELTK PA
4
938-954 (17) SMTTILKPSADFLTSNK PA
4
958-968 (11) YSWFFFDVLIK PA
4
969-979 (11) SMAQHLIENSK PA
4
988-1010 (23) FPASYHHAVETVVNMLMPHITQK PA
4
1020-1030 (11) NANHSLAVFIK PA
4
1044-1058 (15) QINNYISCFAPGDPK PA
4
1070-1088 (19) VVCNHEHYIPLNLPMPFGK PA
4
1094-1109 (16) YQDLQLDYSLTDEFCR PA
4
1110-1119 (10) NHFLVGLLLR PA
4
1120-1129 (10) EVGTALQEFR PA
4
1133-1140 (8) LIAISVLK PA
4
1161-1178 (18) IATLYLPLFGLLIENVQR PA
4
1183-1196 (14) DVSPFPVNAGMTVK PA
4
1197-1213 (17) DESLALPAVNPLVTPQK PA
4
1214-1223 (10) GSTLDNSLHK PA
4
1224-1247 (24) DLLGAISGIASPYTTSTPNINSVR PA
3
1253-1267 (15) GSLISTDSGNSLPER PA
3
1278-1290 (13) HQQSSTLGNSVVR PA
3
1301-1311 (11) SLLMCFLYILK PA
3
1312-1324 (13) SMSDDALFTYWNK PA
3
1325-1349 (25) ASTSELMDFFTISEVCLHQFQYMGK PA
3
1362-1415 (54) LQQLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFK PA
2
1416-1429 (14) NQLLADHGHNPLMK PA
3
1431-1441 (11) VFDVYLCFLQK PA
3
1442-1449 (8) HQSETALK PA
3
1462-1470 (9) FPSTFYEGR PA
3
1471-1483 (13) ADMCAALCYEILK PA
3
1494-1505 (12) TEASQLLYFLMR PA
3
1506-1513 (8) NNFDYTGK PA
3
1519-1541 (23) THLQVIISVSQLIADVVGIGGTR PA
3
1542-1557 (16) FQQSLSIINNCANSDR PA
3
1561-1569 (9) HTSFSSDVK PA
3
1577-1586 (10) TVLMATAQMK PA
6
1587-1604 (18) EHENDPEMLVDLQYSLAK PA
3
1605-1613 (9) SYASTPELR PA
4
1615-1622 (8) TWLDSMAR PA
3
1627-1650 (24) NGDLSEAAMCYVHVTALVAEYLTR PA
3
1652-1670 (19) EAVQWEPPLLPHSHSACLR PA
3
1686-1726 (41) VITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWK PA
3
1730-1738 (9) YELIADIYK PA
3
1739-1746 (8) LIIPIYEK PA
3
1753-1762 (10) LAHLYDTLHR PA
3
1767-1775 (9) VTEVMHSGR PA
3
1784-1812 (29) VAFFGQAAQYQFTDSETDVEGFFEDEDGK PA
2
1821-1830 (10) LTPLSEISQR PA
3
1862-1877 (16) YAYIQVTHVIPFFDEK PA
3
1895-1906 (12) FMFEMPFTQTGK PA
3
1908-1916 (9) QGGVEEQCK PA
3
1919-1931 (13) TILTAIHCFPYVK PA
3
1934-1956 (23) IPVMYQHHTDLNPIEVAIDEMSK PA
3
1963-1974 (12) QLCSSAEVDMIK PA
3
1979-1996 (18) LQGSVSVQVNAGPLAYAR PA
3
1997-2005 (9) AFLDDTNTK PA
3
2021-2035 (15) QFVEACGQALAVNER PA
3
2039-2049 (11) EDQLEYQEEMK PA
3
2058-2068 (11) ELSEIMHEQLG PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center