Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BZC1-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-49 (45) MATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMK PA
4
56-63 (8) LFIGQIPR PA
4
69-79 (11) DLKPLFEEFGK PA
4
80-87 (8) IYELTVLK PA
8
96-105 (10) GCAFLTYCER PA
4
111-119 (9) AQSALHEQK PA
10
120-138 (19) TLPGMNRPIQVKPADSESR PA
8
153-160 (8) LFVGMLNK PA
6
161-168 (8) QQSEDDVR PA
4
170-184 (15) LFEAFGNIEECTILR PA
4
198-227 (30) YSSHAEAQAAINALHGSQTMPGASSSLVVK PA
4
240-413 (174) MQQMAGQMGMFNPMAIPFGAYGAYAQAMQQQAALMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTP
PGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQ
AFPQPPPMIPQQQR PA
1
414-468 (55) EGPEGCNLFIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAIQAMNGFQIGMK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center