Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9C091-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MGNSYAGQLK PA
5
14-27 (14) FEEALHNSIEASLR PA
2
28-57 (30) CSSVVPRPIFSQLYLDPDQHPFSSADVKPK PA
2
69-125 (57) YTQNGSLDFSNNLTVNEMEDDEDDEEMSDSNSPPIPYSQKPAPEGSCTTDGFCQAGK PA
2
129-149 (21) LVSLCMEQIDIPAGFLLVGAK PA
2
150-164 (15) SPNLPEHILVCAVDK PA
2
166-173 (8) FLPDDHGK PA
2
174-189 (16) NALLGFSGNCIGCGER PA
2
193-204 (12) YFTEFSNHINLK PA
2
222-229 (8) SSQGVLSK PA
2
242-271 (30) QSSASCHSIKPSSSVSSTVTPENGTTNGYK PA
2
272-289 (18) SGFTQTDAANGNSSHGGK PA
2
290-326 (37) GSASSSTPAHTGNYSLSPRPSYASGDQATMFISGPPK PA
2
331-355 (25) GWYPGSPLPQPGLVVPVPTVRPLSR PA
2
356-428 (73) TEPLLSAPVPQTPLTGILQPRPIPAGETVIVPENLLSNSGVRPVILIGYGTLPYFYGNVGDIVVSPLLVNCYK PA
2
440-463 (24) LGLTGSQFLSVENMILLTIQYLVR PA
2
464-472 (9) LGPDQVPLR PA
1
473-481 (9) EEFEQIMLK PA
1
482-489 (8) AMQEFTLR PA
1
492-512 (21) ALQIGAQCVPVSPGQLPWLAR PA
1
513-540 (28) LIASVSQDLVHVVVTQNSLAEGISETLR PA
1
551-562 (12) LPDYVVVICASK PA
1
565-579 (15) GNEFCVVVLGQHQSR PA
1
580-593 (14) ALAESMLTTSEFLK PA
2
594-603 (10) EISYELITGK PA
2
604-612 (9) VSFLASHFK PA
2
613-622 (10) TTSLGDDLDK PA
2
632-679 (48) GDSVVTPFDGDLNECVSPQEAAAMIPTQNLDLDNETFHIYQPQLTVAR PA
2
681-703 (23) LLSQVCAIADSGSQSLDLGHFSK PA
2
704-712 (9) VDFIIIVPR PA
2
713-723 (11) SEVLVQQTLQR PA
2
726-744 (19) QSGVLVDLGLEENGTAHQR PA
1
752-759 (8) LDNEIQTK PA
1
769-806 (38) QNPYTLFVLVHDNSHVELTSVISGSLSHSEPSHGLADR PA
1
812-837 (26) EVLEAFNLLVLQVSSFPYTLQTQQSR PA
1
838-860 (23) ISSSNEVHWIQLDTGEDVGCEEK PA
1
861-870 (10) LYFGLSEYSK PA
1
871-882 (12) SLQWGITSPLLR PA
1
890-897 (8) MVNTLLER PA
1
908-929 (22) CYLLIQQYSEALMALTTMASLR PA
1
930-949 (20) DHSTPETLSIMDDLISSPGK PA
1
962-972 (11) VPSVQLAMLAK PA
1
988-1008 (21) FEIILGNPATELSVATHFVAR PA
1
1014-1023 (10) GNEPEEWIPR PA
1
1024-1040 (17) TYQDLDGLPCIVILTGK PA
1
1041-1049 (9) DPLGETFPR PA
1
1058-1066 (9) LIDSSYLTR PA
1
1067-1082 (16) TALEQEVGLACCYVSK PA
1
1087-1097 (11) GPTVALDLSGK PA
1
1102-1146 (45) AAVSENDSDELLIDLERPQSNSSAVTGTSGSIMENGVSSSSTADK PA
1
1150-1183 (34) QSLTPSFQSPATSLGLDEGVSASSAGAGAGETLK PA
1
1184-1209 (26) QECDSLGPQMASSTTSKPSSSSSGPR PA
1
1210-1219 (10) TLPWPGQPIR PA
1
1223-1236 (14) GPQAALPPVVILSK PA
1
1237-1246 (10) AAYSLLGSQK PA
1
1250-1274 (25) LPSSSSLLPHADVAWVSSLRPLLNK PA
1
1275-1286 (12) DMSSEEQSLYYR PA
1
1293-1309 (17) QHHADYSNQLDPASGTR PA
1
1316-1326 (11) LLLTGPPQVGK PA
1
1327-1335 (9) TGSYLQFLR PA
1
1344-1381 (38) LLEVDVYDEEEINTDHNESSEVSQSEGEPWPDIESFSK PA
1
1382-1392 (11) MPFDVSVHDPK PA
1
1393-1403 (11) YSLMSLVYTEK PA
1
1424-1432 (9) ETVSIMLTK PA
1
1433-1446 (14) YAAYNTFHHCEQCR PA
1
1447-1484 (38) QYMDFTSASQMSDSTLHAFTFSSSMLGEEVQLYFIIPK PA
1
1487-1494 (8) ESHFVFSK PA
1
1517-1526 (10) SPIFTPSSGR PA
1
1527-1550 (24) HEHGLLNLFHAMEGISHLHLLVVK PA
1
1551-1558 (8) EYEMPLYR PA
1
1560-1582 (23) YWPNHIMLVLPGMFNNAGVGAAR PA
1
1587-1597 (11) ELSYHNLELER PA
3
1608-1644 (37) QCVWPFIVMMDDSCVLWNIHSVQEPSSQPMEVGVSSK PA
1
1650-1660 (11) TVLQHIEATPK PA
1
1661-1671 (11) IVHYAILGIQK PA
1
1688-1710 (23) CHVHDFILLNTDLTQNVQYDFNR PA
1
1711-1721 (11) YFCEDADFNLR PA
1
1722-1731 (10) TNSSGLLICR PA
1
1732-1739 (8) FNNFSLMK PA
1
1741-1748 (8) HVQVGGQR PA
1
1756-1791 (36) IMVSESLAPILPLQYICAPDSEHTLLAAPAQFLLEK PA
1
1792-1799 (8) FLQHASYK PA
1
1810-1863 (54) SPVLAIDCYLNIGPEVAICYISSRPHSSNVNCEGVFFSGLLLYLCDSFVGADLK PA
1
1870-1880 (11) GATLCVICQDR PA
3
1890-1899 (10) LELEDEWQFR PA
3
1902-1921 (20) DEFQTANSSDDKPLYFLTGR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center