Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9C0B9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-32 (27) LPLKPTHPAEPPPEAEEPEADARPGAK PA
0
40-55 (16) DCRPPPPPPPPAGPSR PA
0
56-65 (10) GPLPPPPPPR PA
0
66-93 (28) GLGPPVAGGAAAGAGMPGGGGGPSAALR PA
0
98-111 (14) VYEWFGLVLGSAQR PA
0
112-128 (17) LEFMCGLLDLCNPLELR PA
0
129-139 (11) FLGSCLEDLAR PA
0
152-165 (14) ANGLSDPGPLADFR PA
0
173-185 (13) LIVYLALLGSENR PA
0
194-203 (10) LLPQVDSVLK PA
0
222-233 (12) GEDGDGEQDAEK PA
0
234-246 (13) DGSGPEGGIVEPR PA
0
247-254 (8) VGGGLGSR PA
0
255-277 (23) AQEELLLLFTMASLHPAFSFHQR PA
0
293-306 (14) GGPEDAEVEVEPCK PA
0
312-346 (35) AQNNSAHGDYMQNNESSLIEQAPIPQDGLTVAPHR PA
0
377-389 (13) VNWSDLSVTTVTK PA
1
390-400 (11) THQELQEFLLK PA
1
404-412 (9) ELSSETFDK PA
1
417-424 (8) ALNQGSLK PA
1
430-438 (9) HPDLEPILR PA
1
439-453 (15) QLFSSSSQAFLQSQK PA
1
454-477 (24) VHSFFQSISSDSLHSINNLQSSLK PA
1
487-507 (21) EDSSEASSQEEDVLQHAIIHK PA
1
513-543 (31) SPIVNNIGTSCSPLDGLTMQYSEQNGIVDWR PA
1
545-567 (23) QSCTTIQHPEHCVTSADQHSAEK PA
1
603-615 (13) LSTPQHAHGGTVK PA
1
616-643 (28) DVNLDIGSGHDTCGETSSESYSSPSSPR PA
1
648-656 (9) ESFESEEEK PA
1
659-674 (16) DTDSNSEDSGNPSTTR PA
1
675-712 (38) FTGYGSVNQTVTVKPPVQIASLGNENGNLLEDPLNSPK PA
1
713-732 (20) YQHISFMPTLHCVMHNGAQK PA
1
733-746 (14) SEVVVPAPKPADGK PA
1
747-762 (16) TIGMLVPSPVAISAIR PA
1
763-784 (22) ESANSTPVGILGPTACTGESEK PA
1
785-814 (30) HLELLASPLPIPSTFLPHSSTPALHLTVQR PA
1
817-870 (54) LPPPQGSSESCTVNIPQQPPGSLSIASPNTAFIPIHNPGSFPGSPVATTDPITK PA
1
871-899 (29) SASQVVGLNQMVPQIEGNTGTVPQPTNVK PA
1
900-1017 (118) VVLPAAGLSAAQPPASYPLPGSPLAAGVLPSQNSSVLSTAATSPQPASAGISQAQATVPPAVPTHTPGPAPSPSPALTHS
TAQSDSTSYISAVGNTNANGTVVPPQQMGSGPCGSCGR PA
1
1019-1044 (26) CSCGTNGNLQLNSYYYPNPMPGPMYR PA
1
1045-1106 (62) VPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQANYGMQQMAGFGR PA
1
1107-1126 (20) FYPVYPAPNVVANTSGSGPK PA
1
1128-1147 (20) NGNVSCYNCGVSGHYAQDCK PA
1
1148-1160 (13) QSSMEANQQGTYR PA
1
1163-1178 (16) YAPPLPPSNDTLDSAD PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center