Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9C0B9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MQNNESSLIEQAPIPQDGLTVAPHR PA
0
56-68 (13) VNWSDLSVTTVTK PA
1
69-79 (11) THQELQEFLLK PA
1
83-91 (9) ELSSETFDK PA
1
96-103 (8) ALNQGSLK PA
1
109-117 (9) HPDLEPILR PA
1
118-132 (15) QLFSSSSQAFLQSQK PA
1
133-156 (24) VHSFFQSISSDSLHSINNLQSSLK PA
1
166-186 (21) EDSSEASSQEEDVLQHAIIHK PA
1
192-222 (31) SPIVNNIGTSCSPLDGLTMQYSEQNGIVDWR PA
1
224-246 (23) QSCTTIQHPEHCVTSADQHSAEK PA
1
282-294 (13) LSTPQHAHGGTVK PA
1
295-322 (28) DVNLDIGSGHDTCGETSSESYSSPSSPR PA
1
327-335 (9) ESFESEEEK PA
1
338-353 (16) DTDSNSEDSGNPSTTR PA
1
354-391 (38) FTGYGSVNQTVTVKPPVQIASLGNENGNLLEDPLNSPK PA
1
392-411 (20) YQHISFMPTLHCVMHNGAQK PA
1
412-425 (14) SEVVVPAPKPADGK PA
1
426-441 (16) TIGMLVPSPVAISAIR PA
1
442-463 (22) ESANSTPVGILGPTACTGESEK PA
1
464-493 (30) HLELLASPLPIPSTFLPHSSTPALHLTVQR PA
1
496-549 (54) LPPPQGSSESCTVNIPQQPPGSLSIASPNTAFIPIHNPGSFPGSPVATTDPITK PA
1
550-578 (29) SASQVVGLNQMVPQIEGNTGTVPQPTNVK PA
1
579-696 (118) VVLPAAGLSAAQPPASYPLPGSPLAAGVLPSQNSSVLSTAATSPQPASAGISQAQATVPPAVPTHTPGPAPSPSPALTHS
TAQSDSTSYISAVGNTNANGTVVPPQQMGSGPCGSCGR PA
1
698-723 (26) CSCGTNGNLQLNSYYYPNPMPGPMYR PA
1
724-785 (62) VPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQANYGMQQMAGFGR PA
1
786-805 (20) FYPVYPAPNVVANTSGSGPK PA
1
807-826 (20) NGNVSCYNCGVSGHYAQDCK PA
1
827-839 (13) QSSMEANQQGTYR PA
1
842-857 (16) YAPPLPPSNDTLDSAD PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center