Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9C0G0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MMDSENKPENDEDEK PA
2
26-50 (25) LSSHNEDGGPVSDVIASFPENSMGK PA
2
52-68 (17) GFSESSNSDSVVIGEDR PA
2
78-85 (8) LDEAEPLK PA
2
94-113 (20) LETSESSVTEGGIALDETGK PA
2
114-146 (33) ETFLSDCTVGGTCLPNALSPSCNFSTIDVVSLK PA
2
152-164 (13) TSAQEMVSLDLER PA
2
172-187 (16) EISVSCTIGNVDTVLK PA
2
188-203 (16) CSICGHLFSSCSDLEK PA
2
204-213 (10) HAESHMQQPK PA
2
214-223 (10) EHTCCHCSHK PA
2
224-235 (12) AESSSALHMHIK PA
2
243-266 (24) VFSCDLCGFQCSEENLLNAHYLGK PA
2
278-286 (9) GGFVQILTK PA
2
337-352 (16) QSGSSSELLVEMMPSR PA
2
353-380 (28) NTLSQEVEIVEEHVTSLGLAQNPENQSR PA
2
382-394 (13) LDTLVTSEGLLEK PA
2
400-418 (19) NTLQAAHGNSVTSRPRPER PA
2
419-428 (10) NILVLGNSFR PA
2
470-478 (9) THDAESVLK PA
2
479-488 (10) HLEACSSVQR PA
2
489-540 (52) VCVTTSETQEAEQGQGSARPPDSGLHSLTVKPASGSQTLCACTDCGQVATNR PA
2
541-548 (8) TDLEIHVK PA
2
561-569 (9) TCDFSSMSR PA
2
571-604 (34) DLDEHLHSNQHQQTASVLSCQCCSFISLDEINLR PA
2
611-628 (18) HNMHFLCTPCNLFFLSEK PA
2
639-647 (9) HINSLVQPK PA
2
648-672 (25) TLQSSNSDLVLQTLPLSTLESENAK PA
2
673-680 (8) ESMDDSGK PA
2
681-688 (8) ASQEEPLK PA
2
691-698 (8) VSHGNEVR PA
2
699-708 (10) HSSKPQFQCK PA
2
728-737 (10) HGQDYHFLCK PA
2
738-746 (9) ACNLYSLSK PA
2
765-777 (13) NNIGLSFEECIER PA
2
778-785 (8) VCIGANDK PA
2
787-796 (10) EEFDVSGNGR PA
2
797-813 (17) IEGHIGVQLQEHSYLEK PA
2
814-829 (16) GMLASEELSQSGGSTK PA
2
830-840 (11) DDELASTTTPK PA
2
851-870 (20) TCSHCGLLASSITNLTVHIR PA
2
873-882 (10) HSHQYSYLCK PA
2
907-914 (8) VEIEASGK PA
2
915-932 (18) HSSDIIVGPEGGSLEAGK PA
2
934-962 (29) NAGSAVTMSDEHANKPAESPTSVLEKPDR PA
2
963-988 (26) GNSIEAEVENVFHSLDGEVNSHLLDK PA
2
990-1009 (20) EQISSEPEDFAQPGDVYSQR PA
2
1010-1018 (9) DVTGTGENK PA
2
1019-1037 (19) CLHCEFSAHSSASLELHVK PA
2
1043-1058 (16) EFEFYCMACDYYAVTR PA
2
1075-1092 (18) QSYLNSANVEAGSADMSK PA
2
1093-1120 (28) NIIMPEEEHQQNSEEFQIISGQPSDTLK PA
2
1123-1140 (18) NAADCSILNENTNLDMSK PA
2
1141-1174 (34) VLCAADSVEVETEEESNFNEDHSFCETFQQAPVK PA
2
1179-1197 (19) KPEEMMSLTMSSNYGSPSR PA
2
1198-1214 (17) FQNENSGSSALNCETAK PA
2
1216-1227 (12) NHEISNDAGELR PA
2
1228-1247 (20) VHCEGEGGNAGDGGGVVPHR PA
2
1248-1258 (11) HLCPVTLDGER PA
2
1259-1269 (11) SAESPVLVVTR PA
2
1273-1284 (12) EQGNLESGGQNR PA
2
1288-1295 (8) GHGLEDLK PA
2
1296-1306 (11) GVQEDPVLGNK PA
2
1307-1346 (40) EILMNSQHETEFILEEDGPASDSTVESSDVYETIISIDDK PA
2
1347-1355 (9) GQAMYSFGR PA
2
1365-1385 (21) NPEDGELIDQSEEGLIATGVR PA
2
1403-1413 (11) SEGSSIGESTR PA
2
1416-1436 (21) CDDCGFLADGLSGLNVHIAMK PA
2
1443-1451 (9) HFHCLLCGK PA
2
1452-1470 (19) SFYTESNLHQHLASAGHMR PA
2
1471-1487 (17) NEQASVEELPEGGATFK PA
2
1491-1506 (16) CTEPFDSEQNLFLHIK PA
2
1507-1514 (8) GQHEELLR PA
2
1519-1529 (11) YIVEDTEQINR PA
2
1532-1540 (9) EENQGNVCK PA
2
1548-1559 (12) SSNSMAFLAHIR PA
2
1560-1568 (9) THTGSKPFK PA
2
1571-1583 (13) ICHFATAQLGDAR PA
2
1597-1607 (11) CHVCGVAFVMK PA
2
1609-1617 (9) HLNTHLLGK PA
2
1628-1635 (8) FTCHLCDR PA
1
1641-1648 (8) WALNNHMK PA
1
1649-1657 (9) LHTGEKPFK PA
12
1658-1674 (17) CTWPTCHYSFLTASAMK PA
1
1685-1698 (14) SFLCDLCGFAGGTR PA
1
1707-1715 (9) QHTGEKPFK PA
1
1716-1731 (16) CDECNFASTTQSHLTR PA
1
1735-1743 (9) VHTGEKPYR PA
13
1751-1758 (8) SNCAENIR PA
1
1778-1789 (12) CDYGTNVPVEFR PA
1
1794-1814 (21) EQHPDIENPDLAYLHAGIVSK PA
0
1822-1846 (25) GQGATFVETDSPFTAAALAEEPLVK PA
0
1855-1901 (47) RPAPPPEQVQQVIIFQGYDGEFALDPSVEETAAATLQTLAMAGQVAR PA
0
1902-1969 (68) VVHITEDGQVIATSQSGAHVGSVVPGPILPEQLADGATQVVVVGGSMEGHGMDESLSPGGAVIQQVTK PA
0
1970-2005 (36) QEILNLSEAGVAPPEASSALDALLCAVTELGEVEGR PA
0
2006-2017 (12) AGLEEQGRPGAK PA
0
2018-2071 (54) DVLIQLPGQEVSHVAADPEAPEIQMFPQAQESPAAVEVLTQVVHPSAAMASQER PA
0
2079-2099 (21) MVQGVLQFAVCDTAAAGQLVK PA
0
2100-2215 (116) DGVTQVVVSEEGAVHMVAGEGAQIIMQEAQGEHMDLVESDGEISQIIVTEELVQAMVQESSGGFSEGTTHYILTELPPGVQDEPGLYSHTVLETADSQELLQAGATLGTEAGAPSR PA
0
2216-2240 (25) AEQLASVVIYTQEGSSAAAAIQSQR PA
0
2241-2248 (8) ESSELQEA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center