Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H0R8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-14 (8) EDHPFEYR PA
1
49-65 (17) YLVPSDLTVGQFYFLIR PA
2
68-117 (50) IHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center