Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H114-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-21 (14) NPLLLLIALVLSAK PA
0
40-63 (24) NMNSTLNFFIQSYNNASNDTYLYR PA
0
70-85 (16) SQMQLTTGVEYIVTVK PA
0
94-106 (13) NDTSNSSCPLQSK PA
0
111-142 (32) SLICESLIYTMPWINYFQLWNNSCLEAEHVGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center