Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H159-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MNCYLLLR PA
1
9-29 (21) FMLGIPLLWPCLGATENSQTK PA
1
44-67 (24) GWVWNQFFVPEEMNTTSHHIGQLR PA
1
68-80 (13) SDLDNGNNSFQYK PA
1
81-95 (15) LLGAGAGSTFIIDER PA
1
96-104 (9) TGDIYAIQK PA
1
117-126 (10) AQVIDIATGR PA
1
127-137 (11) AVEPESEFVIK PA
1
138-147 (10) VSDINDNEPK PA
1
148-185 (38) FLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNAR PA
1
186-207 (22) LLYSLLQGQPYFSVEPTTGVIR PA
1
215-227 (13) ELQDEYWVIIQAK PA
1
228-245 (18) DMIGQPGALSGTTSVLIK PA
1
246-257 (12) LSDVNDNKPIFK PA
1
263-319 (57) LTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILK PA
1
322-333 (12) VDFEHQNHYGIR PA
1
338-347 (10) NHHVPEQLMK PA
1
348-358 (11) YHTEASTTFIK PA
1
359-400 (42) IQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNR PA
1
413-430 (18) VFNINDNGTITTSNSLDR PA
1
431-445 (15) EISAWYNLSITATEK PA
1
446-496 (51) YNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQTISAVDR PA
0
497-535 (39) DESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNR PA
0
536-594 (59) TGFNLQEEPVFYISILIADNGIPSLTSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFK PA
0
595-619 (25) TEVIIAILICIMIIFGFIFLTLGLK PA
0
636-660 (25) ENIFQYDDEGGGEEDTEAFDIAELR PA
0
684-696 (13) QSLQVGPDSAIFR PA
0
703-756 (54) LEEANTDPCAPPFDSLQTYAFEGTGSLAGSLSSLESAVSDQDESYDYLNELGPR PA
0
760-772 (13) LACMFGSAVQSNN PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center