Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H1L0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MPSCSCALMAPCGPAAGPAAVER PA
0
37-50 (14) GQLQVSPEMSITHK PA
0
59-88 (30) EILLFVNAEAFSQPQPHSAPVCEGQQLTGK PA
0
89-96 (8) FSTSVLTR PA
0
97-108 (12) AGGDASPCSWER PA
0
109-117 (9) LLCYGWSHC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center