Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H2B2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MAPITTSR PA
1
9-40 (32) EEFDEIPTVVGIFSAFGLVFTVSLFAWICCQR PA
0
59-70 (12) GVDIYPENLNSK PA
1
90-98 (9) NSLHLDLEK PA
1
100-107 (8) DLNGNFPK PA
1
108-124 (17) TNLKPGSPSDLENATPK PA
1
132-140 (9) ESVSPESLK PA
1
141-150 (10) SSTSLTSEEK PA
1
154-167 (14) LGTLFFSLEYNFER PA
1
179-195 (17) GLPAMDEQSMTSDPYIK PA
1
214-247 (34) TLDPAFDETFTFYGIPYTQIQELALHFTILSFDR PA
1
251-270 (20) DDIIGEVLIPLSGIELSEGK PA
1
289-310 (22) GELLISLCYQSTTNTLTVVVLK PA
1
317-328 (12) SDVSGLSDPYVK PA
1
348-381 (34) CTPNAVFNELFVFDIPCEGLEDISVEFLVLDSER PA
1
385-406 (22) NEVIGQLVLGAAAEGTGGEHWK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center