Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H3U1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MTVSGPGTPEPRPATPGASSVEQLR PA
0
34-62 (29) CGDYGGALAAYTQALGLDATPQDQAVLHR PA
1
108-117 (10) LDQAVLDLQR PA
1
134-142 (9) NIGGQIQEK PA
1
145-152 (8) YMSSTDAK PA
1
153-166 (14) VEQMFQILLDPEEK PA
1
174-183 (10) ASQNLVVLAR PA
1
194-202 (9) SNGVQLLQR PA
1
203-217 (15) LLDMGETDLMLAALR PA
1
218-229 (12) TLVGICSEHQSR PA
1
230-240 (11) TVATLSILGTR PA
1
242-269 (28) VVSILGVESQAVSLAACHLLQVMFDALK PA
1
280-289 (10) EGAIIVDPAR PA
1
293-312 (20) VLISNLLDLLTEVGVSGQGR PA
1
313-321 (9) DNALTLLIK PA
1
330-345 (16) DPNNSLTLWVIDQGLK PA
1
347-368 (22) ILEVGGSLQDPPGELAVTANSR PA
1
369-377 (9) MSASILLSK PA
1
401-411 (11) SWFEGQGLAGK PA
1
414-431 (18) AIQTVSCLLQGPCDAGNR PA
1
432-467 (36) ALELSGVMESVIALCASEQEEEQLVAVEALIHAAGK PA
1
471-483 (13) ASFITANGVSLLK PA
1
505-516 (12) LGSAGGTDFSMK PA
1
517-525 (9) QFAEGSTLK PA
1
533-544 (12) WLCNDQIDAGTR PA
1
546-561 (16) WAVEGLAYLTFDADVK PA
1
562-572 (11) EEFVEDAAALK PA
1
584-608 (25) SVLFAVASALVNCTNSYDYEEPDPK PA
1
618-626 (9) QHVPEQHPK PA
1
639-653 (15) LLAAGVVSAMVCMVK PA
1
654-664 (11) TESPVLTSSCR PA
1
670-681 (12) VFLALVEEVEDR PA
1
682-691 (10) GTVVAQGGGR PA
1
692-707 (16) ALIPLALEGTDVGQTK PA
1
715-729 (15) LTITSNPEMTFPGER PA
1
730-766 (37) IYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISER PA
2
776-792 (17) AVPMIEGYMFEEHEMIR PA
2
794-806 (13) AATECMCNLAMSK PA
2
807-819 (13) EVQDLFEAQGNDR PA
2
822-836 (15) LLVLYSGEDDELLQR PA
2
837-855 (19) AAAGGLAMLTSMRPTLCSR PA
2
856-881 (26) IPQVTTHWLEILQALLLSSNQELQHR PA
2
882-894 (13) GAVVVLNMVEASR PA
2
895-914 (20) EIASTLMESEMMEILSVLAK PA
2
915-922 (8) GDHSPVTR PA
2
923-930 (8) AAAACLDK PA
2
931-944 (14) AVEYGLIQPNQDGE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center