Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H3U1-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MTASSVEQLR PA
0
19-47 (29) CGDYGGALAAYTQALGLDATPQDQAVLHR PA
1
93-102 (10) LDQAVLDLQR PA
1
119-127 (9) NIGGQIQEK PA
1
130-137 (8) YMSSTDAK PA
1
138-151 (14) VEQMFQILLDPEEK PA
1
159-168 (10) ASQNLVVLAR PA
1
179-187 (9) SNGVQLLQR PA
1
188-202 (15) LLDMGETDLMLAALR PA
1
203-214 (12) TLVGICSEHQSR PA
1
215-225 (11) TVATLSILGTR PA
1
227-254 (28) VVSILGVESQAVSLAACHLLQVMFDALK PA
1
265-274 (10) EGAIIVDPAR PA
1
278-297 (20) VLISNLLDLLTEVGVSGQGR PA
1
298-306 (9) DNALTLLIK PA
1
315-330 (16) DPNNSLTLWVIDQGLK PA
1
332-353 (22) ILEVGGSLQDPPGELAVTANSR PA
1
354-362 (9) MSASILLSK PA
1
386-396 (11) SWFEGQGLAGK PA
1
399-416 (18) AIQTVSCLLQGPCDAGNR PA
1
417-452 (36) ALELSGVMESVIALCASEQEEEQLVAVEALIHAAGK PA
1
456-468 (13) ASFITANGVSLLK PA
1
490-501 (12) LGSAGGTDFSMK PA
1
502-510 (9) QFAEGSTLK PA
1
518-529 (12) WLCNDQIDAGTR PA
1
531-546 (16) WAVEGLAYLTFDADVK PA
1
547-557 (11) EEFVEDAAALK PA
1
569-593 (25) SVLFAVASALVNCTNSYDYEEPDPK PA
1
603-611 (9) QHVPEQHPK PA
1
624-638 (15) LLAAGVVSAMVCMVK PA
1
639-649 (11) TESPVLTSSCR PA
1
655-666 (12) VFLALVEEVEDR PA
1
667-676 (10) GTVVAQGGGR PA
1
677-692 (16) ALIPLALEGTDVGQTK PA
1
700-714 (15) LTITSNPEMTFPGER PA
1
715-751 (37) IYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISER PA
2
761-777 (17) AVPMIEGYMFEEHEMIR PA
2
779-791 (13) AATECMCNLAMSK PA
2
792-804 (13) EVQDLFEAQGNDR PA
2
807-821 (15) LLVLYSGEDDELLQR PA
2
822-840 (19) AAAGGLAMLTSMRPTLCSR PA
2
841-866 (26) IPQVTTHWLEILQALLLSSNQELQHR PA
2
867-879 (13) GAVVVLNMVEASR PA
2
880-899 (20) EIASTLMESEMMEILSVLAK PA
2
900-907 (8) GDHSPVTR PA
2
908-915 (8) AAAACLDK PA
2
916-929 (14) AVEYGLIQPNQDGE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center