Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H3U1-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-44 (37) IYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISER PA
2
54-70 (17) AVPMIEGYMFEEHEMIR PA
2
72-84 (13) AATECMCNLAMSK PA
2
85-97 (13) EVQDLFEAQGNDR PA
2
100-114 (15) LLVLYSGEDDELLQR PA
2
115-133 (19) AAAGGLAMLTSMRPTLCSR PA
2
134-159 (26) IPQVTTHWLEILQALLLSSNQELQHR PA
2
160-172 (13) GAVVVLNMVEASR PA
2
173-192 (20) EIASTLMESEMMEILSVLAK PA
2
193-200 (8) GDHSPVTR PA
2
201-208 (8) AAAACLDK PA
2
209-222 (14) AVEYGLIQPNQDGE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center