Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H579-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-37 (31) ICSQEEVVIPCAYDSDSESVDLELSNLEIIK PA
1
39-66 (28) GSSSIELTDLDIPDIPGLHCEPLSHSPR PA
1
67-81 (15) HLTQQDPLSEAIVEK PA
1
103-121 (19) FLGDLSSLSQALPYDETAK PA
1
122-152 (31) SFIHSHIADIVHTLNVLVQEERPHSLSSSMR PA
1
153-176 (24) QEVFVTIADLSYQDVHLLLGSEDR PA
1
177-185 (9) AELFSLTIK PA
1
186-194 (9) SIITLPSVR PA
1
195-215 (21) TLTQIQEIMPNGTCNTECLYR PA
1
216-231 (16) QTFQAFSEMLQSLVVK PA
1
232-243 (12) DPHLENLDTIIK PA
1
251-268 (18) LGHLVALMALLCGDPQEK PA
1
269-286 (18) VAEEAAEGIHSLLHITLR PA
1
309-319 (11) EFLELHSSAAK PA
1
320-327 (8) CFYNCPFR PA
1
328-353 (26) IAQVFEGFLDSNELCQFIMTTFDTLK PA
0
363-373 (11) SAGELLLTLAK PA
0
374-381 (8) NTESQFEK PA
0
382-400 (19) VPEIMGVICAQLSIISQPR PA
0
403-417 (15) QQIINTVSLFISRPK PA
1
418-435 (18) YTDIVLSFLLCHPVPYNR PA
1
443-457 (15) MLSVELPSTTWILWR PA
1
465-473 (9) CHNEPAQEK PA
1
474-483 (10) MAYVAVAVSP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center