Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H579-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-37 (31) ICSQEEVVIPCAYDSDSESVDLELSNLEIIK PA
1
39-66 (28) GSSSIELTDLDIPDIPGLHCEPLSHSPR PA
1
67-81 (15) HLTQQDPLSEAIVEK PA
1
103-121 (19) FLGDLSSLSQALPYDETAK PA
1
122-152 (31) SFIHSHIADIVHTLNVLVQEERPHSLSSSMR PA
1
153-176 (24) QEVFVTIADLSYQDVHLLLGSEDR PA
1
177-185 (9) AELFSLTIK PA
1
186-194 (9) SIITLPSVR PA
1
195-215 (21) TLTQIQEIMPNGTCNTECLYR PA
1
216-231 (16) QTFQAFSEMLQSLVVK PA
1
232-243 (12) DPHLENLDTIIK PA
1
251-268 (18) LGHLVALMALLCGDPQEK PA
1
269-286 (18) VAEEAAEGIHSLLHITLR PA
1
309-319 (11) EFLELHSSAAK PA
1
320-327 (8) CFYNCPFR PA
1
328-349 (22) IAQVPEIMGVICAQLSIISQPR PA
0
352-366 (15) QQIINTVSLFISRPK PA
1
367-384 (18) YTDIVLSFLLCHPVPYNR PA
1
392-406 (15) MLSVELPSTTWILWR PA
1
414-422 (9) CHNEPAQEK PA
1
423-442 (20) MAYVAVAATDALYEVFLGNR PA
0
450-500 (51) LFPQLLMTLLIQIHHSIGLTMSDVDIPSGLYTEQEVPSEVTPLCFAMQATK PA
0
506-517 (12) TCCLQEFNIMEK PA
0
520-527 (8) GWALLGGK PA
0
528-544 (17) DGHLQGLFLLANALLER PA
0
552-562 (11) VMYLLVPLLNR PA
0
569-580 (12) LTSAGSFVELLR PA
0
587-595 (9) LPSIYSVAR PA
0
598-608 (11) DWLQDGNHLFR PA
0
614-625 (12) GLYNLVGHQEMR PA
0
630-640 (11) SLLPYIVDSLR PA
0
646-659 (14) IVLSAIQILLQLVR PA
0
660-671 (12) TMDFTTLAAMMR PA
0
672-681 (10) TLFSLFGDVR PA
0
687-697 (11) FSVTLFGAAIK PA
0
706-734 (29) SIENQVLDSLVPLLLYSQDENDAVAEESR PA
0
735-745 (11) QVLTICAQFLK PA
0
748-755 (8) LPQEVYSK PA
0
756-770 (15) DPWHIKPTEAGTICR PA
0
780-791 (12) INILEQTLMYSK PA
0
800-810 (11) SAVLFVGLLSK PA
0
811-818 (8) YMDHNELR PA
0
820-830 (11) MGTDWIEDDLR PA
0
831-855 (25) DLLCDPEPSLCIIASQTLLLVQMAR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center