Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H706-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MDPAPSLGCSLK PA
2
16-31 (16) WSSVAVPLDLLVSTYR PA
2
38-48 (11) LDNGECVEGLR PA
2
49-59 (11) ENDYLLIHSCR PA
2
60-79 (20) QWTTITAHSLEEGHYVIGPK PA
2
80-91 (12) IEIPVHYAGQFK PA
2
101-114 (14) EPVQYFNSVEEVAK PA
2
120-131 (12) VYVMEDITFNVK PA
2
132-166 (35) VASGECNEDTEVYNITLCTGDELTLMGQAEILYAK PA
2
195-204 (10) MPCLICMNHR PA
5
205-216 (12) TNESISLPFQCK PA
2
223-237 (15) SPLELQMQEGEHTIR PA
2
245-257 (13) LPVNVTVPSPPPR PA
2
258-266 (9) NPYDLHFIR PA
2
280-288 (9) TVVVCCVLR PA
2
292-305 (14) ILPMHFPLHLTVPK PA
2
306-314 (9) FSLPEHLVK PA
2
315-341 (27) GESWPETLVHHWLGICQEQFDIDEYSR PA
2
348-355 (8) TDWNEECK PA
2
362-376 (15) CSGHNHVPNSLSYAR PA
2
377-385 (9) DELTQSFHR PA
2
386-407 (22) LSVCVYGNNLHGNSEVNLHGCR PA
2
408-448 (41) DLGGDWAPFPHDILPYQDSGDSGSDYLFPEASEESAGIPGK PA
2
449-470 (22) SELPYEELWLEEGKPSHQPLTR PA
2
489-513 (25) CATSPLPSPTLSYYSSGLHNISVTK PA
0
514-531 (18) TDTNPSESTPVSCYPCNR PA
2
541-554 (14) SPFGSPSAEAVSSR PA
2
555-570 (16) LSWPNHYSGASESQTR PA
2
571-579 (9) SDFLLDPSR PA
2
595-628 (34) NCPAPFDFDGCELLASPTSPVTAEFSSSVSGCPK PA
2
629-640 (12) SASYSLESTDVK PA
2
641-648 (8) SLAAGVTK PA
2
649-659 (11) QSTSCPALPPR PA
2
668-678 (11) VASETSPLPLK PA
2
679-687 (9) IDGAEEDPK PA
2
688-701 (14) SGSPDLSEDQYFVK PA
2
703-725 (23) GMQDIFSASYPFSSPLHLQLAPR PA
2
726-749 (24) SCGDGSPWQPPADLSGLSIEEVSK PA
2
753-768 (16) FIGLSEDVISFFVTEK PA
2
769-787 (19) IDGNLLVQLTEEILSEDFK PA
2
796-806 (11) IMQFINGWRPK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center