Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H7M6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-19 (9) GCPAGPEER PA
0
20-27 (8) DAGAGAAR PA
0
30-41 (12) GRPEALLDLSAK PA
0
43-55 (13) VAESWAFEQVEER PA
0
67-74 (8) IVFWSFPR PA
0
78-97 (20) EICMYSSLGYPPPEGEHDAR PA
0
103-114 (12) GLHLLQSGAVDR PA
0
115-127 (13) VLQVGFHLSGNIR PA
0
128-137 (10) EPGSPGEPER PA
0
138-147 (10) LYHVSISFDR PA
0
150-160 (11) ITSVSCGCDNR PA
0
161-175 (15) DLFYCAHVVALSLYR PA
0
178-185 (8) HAHQVELR PA
0
186-197 (12) LPISETLSQMNR PA
0
203-221 (19) FVQYLISAHHTEVLPTAQR PA
0
222-266 (45) LADEILLLGSEINLVNGAPDPTAGAGIEDANCWHLDEEQIQEQVK PA
0
267-282 (16) QLLSNGGYYGASQQLR PA
0
302-315 (14) MLILMTEQFLQDTR PA
0
321-329 (9) QQGAGMTDK PA
0
332-355 (24) QLWDELGALWVCVVLSPHCKPEER PA
0
356-364 (9) AGWLQLLSR PA
0
368-398 (31) LDVCPLEEGNYSFDGPSLQPTMAPAPELLQK PA
0
399-422 (24) GSTCITNTEGWVGHPLDPIGCLCR PA
0
430-445 (16) LEEETLTLYPDSGPEK PA
0
448-479 (32) VAYQHVPVPGSPGESYLVLALEVALLGLGQQR PA
0
480-490 (11) ALPEGLYAQDK PA
0
494-510 (17) NEEQLLALLEEVELDER PA
0
518-537 (20) QAGLLLEGGPFSGFGEVLFR PA
0
538-547 (10) ESVPMHTCAR PA
0
548-563 (16) YLFTALLPHDPDLAYR PA
0
571-595 (25) LPILETAFPAGEPHPSPLDSIMSNR PA
0
599-608 (10) WFILGHLETR PA
0
609-621 (13) QCELASTMLTAAK PA
0
626-646 (21) WLHTVLGSIQQNIHSPALLFK PA
0
654-679 (26) TATPVSAPPDTTLLGIALELGLQVMR PA
0
680-688 (9) MTLNVMTWR PA
0
695-740 (46) WLVSCATEIGPQALMNIMQNWYSLFTPVEAATIVAVTGTTHATLLR PA
0
749-756 (8) EELWACAR PA
0
757-765 (9) TLALQCAMK PA
2
766-780 (15) DPQNCALPALTLCEK PA
0
781-810 (30) NHSAFEAAYQIVLDAAAGGLGHAHLFTVAR PA
0
824-859 (36) LATLALAQLSIAFNQDSHPAVNDVLWACSLSHSLGR PA
0
860-871 (12) HELSAIVPLIIR PA
0
872-884 (13) SIHCAPMLSDILR PA
0
886-899 (14) WTLSAPGLGPLGAR PA
0
901-909 (9) AAKPLGADR PA
0
910-930 (21) APLCQLLDAAVTAYITTSHSR PA
0
938-948 (11) HYGDFIEFLGK PA
0
951-971 (21) ETFLLAPDGHLQFSQFLENLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center