Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H7V2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MDGIIEQK PA
0
37-52 (16) DGLVSVYPAPQYQSHR PA
0
53-66 (14) VGASTVPASLDSSR PA
0
67-86 (20) SEPMQQLLDPNTLQQSVESR PA
0
87-100 (14) YRPNIILYSEGVLR PA
0
101-119 (19) SWGDGVAADCCETTFIEDR PA
0
124-132 (9) DSLEYPDGK PA
0
133-142 (10) FIDLSADDIK PA
0
143-179 (37) IHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPR PA
0
180-209 (30) DHLGLSVFSMLCCFWPLGIAAFYLSHETNK PA
0
214-224 (11) GDLHQASTSSR PA
0
226-254 (29) ALFLAVLSITIGTGVYVGVAVALIAYLSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center