Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H808-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
15-39 (25) STSPCPGISNSESSPTLNYQGILNR PA
0
46-63 (18) FSPHFAAELESIYYSLHK PA
0
64-73 (10) IQQDVAEHHK PA
0
74-111 (38) QIGNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVK PA
0
114-127 (14) TLQESSFEDIMATR PA
0
134-150 (17) RPLGEDNQPETQLFWDK PA
1
151-165 (15) EPWFWHDTLTEQLWR PA
1
166-174 (9) IFAGVHDEK PA
1
181-191 (11) QQAPGLGQESK PA
1
192-226 (35) APGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDR PA
1
227-239 (13) NTSWGVVQEPPGR PA
1
243-259 (17) FLQSISWDPEDFEDAWK PA
1
260-269 (10) RPDALPGQSK PA
1
282-299 (18) ILAHGELVLATAISSFTR PA
1
311-322 (12) VWSLTGQVAEDR PA
1
323-338 (16) FPESHLPIQTPGAFLR PA
1
339-347 (9) TCLLSSNSR PA
1
348-372 (25) SLLTGGYNLASVSVWDLAAPSLHVK PA
1
373-404 (32) EQLPCAGLNCQALDANLDANLAFASFTSGVVR PA
1
431-444 (14) GYNIWTGGPDACLR PA
1
450-460 (11) TIMKPLEYQFK PA
1
461-494 (34) SQIMSLSHSPQEDWVLLGMANGQQWLQSTSGSQR PA
1
501-508 (8) DSVILSVK PA
1
509-535 (27) FSPFGQWWASVGMDDFLGVYSMPAGTK PA
1
536-555 (20) VFEVPEMSPVTCCDVSSNNR PA
1
556-572 (17) LVVTGSGEHASVYQITY PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center