Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H8V3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MAENSVLTSTTGR PA
3
14-25 (12) TSLADSSIFDSK PA
3
32-52 (21) ENLLIGSTSYVEEEMPQIETR PA
2
53-61 (9) VILVQEAGK PA
3
74-81 (8) IMEVPVIK PA
1
97-104 (8) SVINMDIK PA
1
110-143 (34) MESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYK PA
3
148-160 (13) VIGPPVVLNCSQK PA
3
161-187 (27) GEPLPFSCRPLYCTSMMNLVLCFTGFR PA
3
195-207 (13) LVTLVHHMGGVIR PA
3
214-226 (13) VTHLVANCTQGEK PA
3
229-245 (17) VAVSLGTPIMKPEWIYK PA
3
251-263 (13) NEQDFYAAVDDFR PA
3
268-286 (19) VPPFQDCILSFLGFSDEEK PA
3
287-299 (13) TNMEEMTEMQGGK PA
3
300-307 (8) YLPLGDER PA
3
308-319 (12) CTHLVVEENIVK PA
3
320-327 (8) DLPFEPSK PA
3
334-346 (13) QEWFWGSIQMDAR PA
3
347-356 (10) AGETMYLYEK PA
3
365-378 (14) SVSMLSLNTPNSNR PA
3
385-392 (8) ETLAQLSR PA
3
393-402 (10) ETDVSPFPPR PA
3
404-434 (31) RPSAEHSLSIGSLLDISNTPESSINYGDTPK PA
3
442-449 (8) SSTPVPSK PA
3
459-488 (30) ELYQTESNYVNILATIIQLFQVPLEEEGQR PA
3
489-499 (11) GGPILAPEEIK PA
3
500-514 (15) TIFGSIPDIFDVHTK PA
3
517-530 (14) DDLEDLIVNWDESK PA
3
531-538 (8) SIGDIFLK PA
3
546-558 (13) TYPPFVNFFEMSK PA
3
577-586 (10) INQAKPECGR PA
3
587-599 (13) QSLVELLIRPVQR PA
3
600-611 (12) LPSVALLLNDLK PA
3
613-621 (9) HTADENPDK PA
3
633-642 (10) EVMTHINEDK PA
3
650-670 (21) QIFDVVYEVDGCPANLLSSHR PA
3
676-688 (13) VETISLGEHPCDR PA
3
689-705 (17) GEQVTLFLFNDCLEIAR PA
3
716-728 (13) SPHGQTRPPASLK PA
3
729-739 (11) HIHLMPLSQIK PA
3
746-780 (35) ETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK PA
3
790-797 (8) HVANTICK PA
3
798-817 (20) ADAENLIYTADPESFEVNTK PA
3
818-825 (8) DMDSTLSR PA
3
854-865 (12) ALMTSHGSVEGR PA
3
878-901 (24) LSSTSSLAGIPSPSLVSLPSFFER PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center