Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H8V3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MAENSVLTSTTGR PA
3
14-25 (12) TSLADSSIFDSK PA
3
32-51 (20) ENLLIGSTSYVEEMPQIETR PA
0
52-60 (9) VILVQEAGK PA
3
78-111 (34) MESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYK PA
3
116-128 (13) VIGPPVVLNCSQK PA
3
129-155 (27) GEPLPFSCRPLYCTSMMNLVLCFTGFR PA
3
163-175 (13) LVTLVHHMGGVIR PA
3
182-194 (13) VTHLVANCTQGEK PA
3
197-213 (17) VAVSLGTPIMKPEWIYK PA
3
219-231 (13) NEQDFYAAVDDFR PA
3
236-254 (19) VPPFQDCILSFLGFSDEEK PA
3
255-267 (13) TNMEEMTEMQGGK PA
3
268-275 (8) YLPLGDER PA
3
276-287 (12) CTHLVVEENIVK PA
3
288-295 (8) DLPFEPSK PA
3
302-314 (13) QEWFWGSIQMDAR PA
3
315-324 (10) AGETMYLYEK PA
3
333-346 (14) SVSMLSLNTPNSNR PA
3
353-360 (8) ETLAQLSR PA
3
361-370 (10) ETDVSPFPPR PA
3
372-402 (31) RPSAEHSLSIGSLLDISNTPESSINYGDTPK PA
3
410-417 (8) SSTPVPSK PA
3
427-456 (30) ELYQTESNYVNILATIIQLFQVPLEEEGQR PA
3
457-467 (11) GGPILAPEEIK PA
3
468-482 (15) TIFGSIPDIFDVHTK PA
3
485-498 (14) DDLEDLIVNWDESK PA
3
499-506 (8) SIGDIFLK PA
3
514-526 (13) TYPPFVNFFEMSK PA
3
545-554 (10) INQAKPECGR PA
3
555-567 (13) QSLVELLIRPVQR PA
3
568-579 (12) LPSVALLLNDLK PA
3
581-589 (9) HTADENPDK PA
3
601-610 (10) EVMTHINEDK PA
3
618-638 (21) QIFDVVYEVDGCPANLLSSHR PA
3
644-656 (13) VETISLGEHPCDR PA
3
657-673 (17) GEQVTLFLFNDCLEIAR PA
3
684-696 (13) SPHGQTRPPASLK PA
3
697-707 (11) HIHLMPLSQIK PA
3
714-748 (35) ETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK PA
3
758-765 (8) HVANTICK PA
3
766-785 (20) ADAENLIYTADPESFEVNTK PA
3
786-793 (8) DMDSTLSR PA
3
822-833 (12) ALMTSHGSVEGR PA
3
846-869 (24) LSSTSSLAGIPSPSLVSLPSFFER PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center