Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H8V3-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MAENSVLTSTTGR PA
3
14-25 (12) TSLADSSIFDSK PA
3
32-52 (21) ENLLIGSTSYVEEEMPQIETR PA
2
53-61 (9) VILVQEAGK PA
3
79-112 (34) MESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYK PA
3
117-129 (13) VIGPPVVLNCSQK PA
3
130-156 (27) GEPLPFSCRPLYCTSMMNLVLCFTGFR PA
3
164-176 (13) LVTLVHHMGGVIR PA
3
183-195 (13) VTHLVANCTQGEK PA
3
198-214 (17) VAVSLGTPIMKPEWIYK PA
3
220-232 (13) NEQDFYAAVDDFR PA
3
237-255 (19) VPPFQDCILSFLGFSDEEK PA
3
256-268 (13) TNMEEMTEMQGGK PA
3
269-276 (8) YLPLGDER PA
3
277-288 (12) CTHLVVEENIVK PA
3
289-296 (8) DLPFEPSK PA
3
303-315 (13) QEWFWGSIQMDAR PA
3
316-325 (10) AGETMYLYEK PA
3
334-347 (14) SVSMLSLNTPNSNR PA
3
354-361 (8) ETLAQLSR PA
3
362-371 (10) ETDVSPFPPR PA
3
373-403 (31) RPSAEHSLSIGSLLDISNTPESSINYGDTPK PA
3
411-418 (8) SSTPVPSK PA
3
428-457 (30) ELYQTESNYVNILATIIQLFQVPLEEEGQR PA
3
458-468 (11) GGPILAPEEIK PA
3
469-483 (15) TIFGSIPDIFDVHTK PA
3
486-499 (14) DDLEDLIVNWDESK PA
3
500-507 (8) SIGDIFLK PA
3
515-527 (13) TYPPFVNFFEMSK PA
3
546-555 (10) INQAKPECGR PA
3
556-568 (13) QSLVELLIRPVQR PA
3
569-580 (12) LPSVALLLNDLK PA
3
582-590 (9) HTADENPDK PA
3
602-611 (10) EVMTHINEDK PA
3
619-639 (21) QIFDVVYEVDGCPANLLSSHR PA
3
645-657 (13) VETISLGEHPCDR PA
3
658-674 (17) GEQVTLFLFNDCLEIAR PA
3
685-697 (13) SPHGQTRPPASLK PA
3
698-708 (11) HIHLMPLSQIK PA
3
715-749 (35) ETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK PA
3
759-766 (8) HVANTICK PA
3
767-786 (20) ADAENLIYTADPESFEVNTK PA
3
787-794 (8) DMDSTLSR PA
3
823-834 (12) ALMTSHGSVEGR PA
3
847-870 (24) LSSTSSLAGIPSPSLVSLPSFFER PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center