Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9H8Y8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-33 (21) ETSVTPSNLWGGQGLLGVSIR PA
2
34-94 (61) FCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLK PA
2
95-106 (12) LYVYNTDTDNCR PA
2
107-133 (27) EVIITPNSAWGGEGSLGCGIGYGYLHR PA
2
134-143 (10) IPTRPFEEGK PA
2
145-160 (16) ISLPGQMAGTPITPLK PA
2
161-282 (122) DGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGVPTVPLLPPQVNQSLTSVPPMNPATTLPGLMPL
PAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPR PA
2
283-335 (53) NLPGIAPLPLPSEFLPSFPLVPESSSAASSGELLSSLPPTSNAPSDPATTTAK PA
2
336-352 (17) ADAASSLTVDVTPPTAK PA
2
353-360 (8) APTTVEDR PA
2
361-384 (24) VGDSTPVSEKPVSAAVDANASESP PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center