Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9HAB3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-39 (39) MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVK PA
0
40-69 (30) ELPEGWSLPSYVSVLVALGNLGLLVVTLWR PA
0
83-142 (60) VVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASNVTFLPFLSHLPPR PA
0
146-169 (24) SFFLGQGLSALLPCVLALVQGVGR PA
1
170-190 (21) LECPPAPINGTPGPPLDFLER PA
0
191-267 (77) FPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSPLQEPPSQAAGTTPGPDPK PA
0
268-275 (8) AYQLLSAR PA
0
276-307 (32) SACLLGLLAATNALTNGVLPAVQSFSCLPYGR PA
0
308-334 (27) LAYHLAVVLGSAANPLACFLAMGVLCR PA
1
335-390 (56) SLAGLGGLSLLGVFCGGYLMALAVLSPCPPLVGTSAGVVLVVLSWVLCLGVFSYVK PA
0
391-436 (46) VAASSLLHGGGRPALLAAGVAIQVGSLLGAVAMFPPTSIYHVFHSR PA
0
438-445 (8) DCADPCDS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center