Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9HB14-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-19 (15) GFSWGPGHLNEDNAR PA
0
20-47 (28) FLLLAALIVLYLLGGAAVFSALELAHER PA
0
95-124 (30) WDFTGAFYFVGTVVSTIGFGMTTPATVGGK PA
0
125-148 (24) IFLIFYGLVGCSSTILFFNLFLER PA
0
149-158 (10) LITIIAYIMK PA
0
169-177 (9) GALPQESLK PA
0
178-258 (81) DAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYR PA
0
259-284 (26) FANFVFILMGVCCIYSLFNVISILIK PA
0
285-292 (8) QSLNWILR PA
0
294-304 (11) MDSGCCPQCQR PA
0
312-320 (9) NVVMPGSVR PA
0
323-340 (18) CNISIETDGVAESDTDGR PA
0
342-350 (9) LSGEMISMK PA
0
358-365 (8) ASLAILQK PA
0
366-383 (18) QLSEMANGCPHQTSTLAR PA
0
384-400 (17) DNEFSGGVGAFAIMNNR PA
0
401-408 (8) LAETSGDR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center