Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9HCE0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAEAVKPQR PA
1
32-41 (10) EESSEVSLPK PA
1
45-56 (12) EQEIPSLACEFK PA
1
62-104 (43) VVTDSQLQDDASGQNESEMFDVPLTSLTISNEESLTCNTEPPK PA
1
105-121 (17) EGGEARPCVGDSAVTPK PA
1
122-131 (10) VHPGDNVGTK PA
1
137-173 (37) NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR PA
1
183-204 (22) QGLVCSSEVPQNVGLQSSCPAK PA
1
215-238 (24) LYPQLPAEIAGEAPALVAVKPLLR PA
1
242-257 (16) LYPELPSQLELVPFTK PA
1
262-287 (26) ILEPGSWLENVESYLEEFDSMAHQDR PA
1
288-299 (12) HEFYELLLNYSR PA
1
303-322 (20) QLLLAEAELLTLTSDCQNAK PA
1
330-344 (15) EEQMSVQGICADQVK PA
1
354-365 (12) VEMNENALVELK PA
1
372-390 (19) SEHLHQTLALHSYTSVLSR PA
1
391-408 (18) LQVESYIYALLSSSAVLR PA
1
409-417 (9) SSAIHQQGR PA
1
421-433 (13) QTESIPSDLCQLK PA
1
434-444 (11) ECISVLFMFTR PA
1
446-462 (17) VNEDTQFHDDILLWLQK PA
1
470-485 (16) VGCPGDHLFLLNHILR PA
1
493-501 (9) WAVPFIQIK PA
1
502-524 (23) VLHNPSGVFHFMQSLALLMSPVK PA
1
527-538 (12) AEFMCHMKPSER PA
1
539-595 (57) KPSSSGPGSGTWTLVDEGGEEDEDPETSWILLNEDDLVTILAQFPFHELFQHLLGFK PA
1
598-612 (15) GDYLPETTRPQEMMK PA
1
613-633 (21) IFAFANSLVELLAVGLETFNR PA
1
649-679 (31) MTLGYVSDHWAQYVSHNQGSGLAQQPYSMEK PA
1
680-690 (11) LQVEFDELFLR PA
1
701-722 (22) LGIWLFMSEMPFGTLSVQMLWK PA
1
723-748 (26) LFYLMHQVESENLQQLSSSLQPAQCK PA
1
749-762 (14) QQLQDPEHFTNFEK PA
1
763-786 (24) CLSSMNSSEEICLLTTFAQMAQAR PA
1
788-796 (9) TNVDEDFIK PA
1
797-813 (17) IIVLEIYEVSYVTLSTR PA
1
822-841 (20) ELLGTITAVHPEIISVLLDR PA
1
842-858 (17) VQETIDQVGMVSLYLFK PA
1
859-876 (18) ELPLYLWQPSASEIAVIR PA
1
877-888 (12) DWLLNYNLTVVK PA
1
891-905 (15) LACVILEGLNWGFAK PA
1
906-929 (24) QATLHLDQAVHAEVALMVLEAYQK PA
1
930-945 (16) YLAQKPYAGILSESMK PA
1
946-955 (10) QVSYLASIVR PA
1
956-974 (19) YGETPETSFNQWAWNLILR PA
1
980-1011 (32) NDYGIQPNCPAVPFSVTVPDMTESPTFHPLLK PA
1
1015-1036 (22) AGMPIGCYLALSMTAVGHSIEK PA
1
1037-1052 (16) FCAEGIPLLGILVQSR PA
1
1056-1063 (8) TVVHVLDK PA
1
1064-1077 (14) ILPLFYPCQYYLLK PA
1
1078-1106 (29) NEQFLSHLLLFLHLDSGVPQGVTQQVTHK PA
1
1107-1121 (15) VAQHLTGASHGDNVK PA
1
1122-1161 (40) LLNSMIQAHISVSTQPNEVGPVAVLEFWVQALISQHLWYR PA
1
1162-1174 (13) EQPILFLMDHLCK PA
1
1175-1187 (13) AAFQLMQEDCIQK PA
1
1195-1203 (9) NALGYHCDR PA
1
1204-1252 (49) SLLSSLVSWIVAGNITPSFVEGLATPTQVWFAWTVLNMESIFEEDSQLR PA
1
1254-1272 (19) VIEGELVINSAFTPDQALK PA
1
1280-1288 (9) LPIVPSLQR PA
1
1294-1314 (21) WAHQALVTPSDHPLLPLIWQK PA
1
1315-1337 (23) FFLLYLHRPGPQYGLPIDGCIGR PA
1
1339-1350 (12) FFQSPAHINLLK PA
1
1356-1368 (13) LTEVADFHHAASK PA
1
1372-1398 (27) VPAEGSEGLPESHSGTPGYLTSPELHK PA
1
1403-1418 (16) LFNVYILWLEDENFQK PA
1
1419-1428 (10) GDTYIPSLPK PA
1
1438-1454 (17) VMQNQQDLWMEYLNMER PA
1
1455-1470 (16) IYHEFQETVGLWTQAK PA
1
1471-1493 (23) LESHSTPCSLSVQLDFTDPLLAK PA
1
1503-1531 (29) HEAPQPPLALHPTKPPVPVISSAVLLSQK PA
1
1532-1549 (18) DATQLVCTDLNLLQQQAR PA
1
1555-1571 (17) ESQQVALDGELLDTMPK PA
1
1577-1587 (11) EEQTTLHLECR PA
1
1594-1609 (16) CQGAAVVTVQFEGMHK PA
1
1610-1621 (12) NEAISQQLHVLR PA
1
1626-1658 (33) QLQAEAAKPPSLNIVEAAVHAENLITALVNAYK PA
1
1659-1667 (9) LQPTPGIQK PA
1
1668-1686 (19) VGISLFFTIVDYVSDETQR PA
1
1692-1710 (19) QFFTSCIEILGQVFISGIK PA
1
1726-1752 (27) LCSLLSPFFTPNAAPAEFIQLYEQVVK PA
1
1753-1768 (16) FLSEDNSDMIFMLLTK PA
1
1773-1785 (13) QWLSATKPPLSDR PA
1
1788-1816 (29) LLESIHLALTAWGLEPDEDILMPFNLFCK PA
1
1817-1835 (19) HWTYLLLYQFPDQYSDILR PA
1
1836-1852 (17) LLMQSSAEQLLSPECWK PA
1
1857-1888 (32) ALGCCAPSCQQGAASTEGAVLPSSSDALLSDK PA
1
1889-1903 (15) QVMETIQWLSDFFYK PA
1
1920-1928 (9) WSPYMADVK PA
1
1929-1936 (8) TFLGYLVK PA
1
1938-1954 (17) LIDLEMTCLAQDPTASR PA
1
1960-1985 (26) SLHSVIIQLFKPWILVLEDNESSQQR PA
1
1986-2016 (31) HYPWLESDTVVASSIVQLFTDCIDSLHESFK PA
1
2019-2042 (24) LLPGDAGALWLHLMHYCEACTAPK PA
1
2043-2056 (14) MPEFILYAFHSTYR PA
1
2062-2075 (14) DLHPDQMLMEAFFK PA
1
2083-2114 (32) SCFLFLGSVLCEVNWVSVLSDAWNSSPHPETR PA
1
2115-2129 (15) SMIVCLLFMMILLAK PA
1
2130-2180 (51) EVQLVDQTDSPLLSLLGQTSSLSWHLVDIVSYQSVLSYFSSHYPPSIILAK PA
1
2181-2189 (9) ESYAELIMK PA
1
2193-2205 (13) VSAGLSIPTDSQK PA
1
2213-2232 (20) CQAFTHQMVQFLSTLEQNGK PA
1
2233-2244 (12) ITLAVLEQEMSK PA
1
2245-2262 (18) LLDDIIVFNPPDMDSQTR PA
1
2263-2289 (27) HMALSSLFMEVLMMMNNATIPTAEFLR PA
1
2300-2320 (21) MHGLVVLPLLTAACQSLASVR PA
1
2321-2335 (15) HMAETTEACITAYFK PA
1
2336-2390 (55) ESPLNQNSGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLR PA
1
2402-2416 (15) WLEQVYPSSVEEEAK PA
1
2417-2445 (29) LFLWWHQVLQLSLIQTEQNDSVLTESVIR PA
1
2446-2453 (8) ILLLVQSR PA
1
2454-2461 (8) QNLVAEER PA
1
2462-2474 (13) LSSGILGAIGFGR PA
1
2488-2504 (17) SMAAFLSVQVPMEDQIR PA
0
2505-2516 (12) LRPGSELHLTPK PA
0
2517-2531 (15) AQQALNALESMASSK PA
0
2532-2548 (17) QYVEYQDQILQATQFIR PA
0
2549-2558 (10) HPGHCLQDGK PA
0
2559-2579 (21) SFLALLVNCLYPEVHYLDHIR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center