Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9HD42-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MDDTLFQLK PA
0
47-54 (8) VYAENAIR PA
0
57-64 (8) NEGVNWLR PA
0
76-83 (8) VQTAVTMK PA
0
99-107 (9) ALSTMDLQK PA
0
115-181 (67) FEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVR PA
0
182-189 (8) SQEDQLSR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center