Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NQC1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-29 (22) YSISSDNSDTTDSHATSTSASR PA
2
55-62 (8) TDLITAMK PA
5
63-82 (20) IPDSYQLSPDDYYILADPWR PA
2
88-104 (17) GVQVPAGAEAIPEPVVR PA
2
105-136 (32) ILPPLEGPPAQASPSSTMLGEGSQPDWPGGSR PA
2
137-155 (19) YDLDEIDAYWLELINSELK PA
2
156-169 (14) EMERPELDELTLER PA
2
170-184 (15) VLEELETLCHQNMAR PA
2
185-206 (22) AIETQEGLGIEYDEDVVCDVCR PA
2
207-221 (15) SPEGEDGNEMVFCDK PA
2
222-235 (14) CNVCVHQACYGILK PA
3
236-244 (9) VPTGSWLCR PA
2
245-253 (9) TCALGVQPK PA
5
261-268 (8) GGALKPTR PA
2
273-292 (20) WVHVSCALWIPEVSIGCPEK PA
2
299-306 (8) ISHIPASR PA
2
307-315 (9) WALSCSLCK PA
2
316-346 (31) ECTGTCIQCSMPSCVTAFHVTCAFDHGLEMR PA
2
347-356 (10) TILADNDEVK PA
2
359-370 (12) SFCQEHSDGGPR PA
2
371-389 (19) NEPTSEPTEPSQAGEDLEK PA
2
397-416 (20) LQQLEEDFYELVEPAEVAER PA
2
417-432 (16) LDLAEALVDFIYQYWK PA
2
437-447 (11) ANANQPLLTPK PA
2
448-464 (17) TDEVDNLAQQEQDVLYR PA
2
481-488 (8) NLCYMVTR PA
2
499-509 (11) LQEQIFHLQMK PA
2
510-517 (8) LIEQDLCR PA
2
518-557 (40) GLSTSFPIDGTFFNSWLAQSVQITAENMAMSEWPLNNGHR PA
0
558-581 (24) EDPAPGLLSEELLQDEETLLSFMR PA
1
582-592 (11) DPSLRPGDPAR PA
1
605-618 (14) KPPPPPPQDGPGSR PA
1
628-637 (10) TWGQDAGSGK PA
1
638-645 (8) GGQGPPTR PA
1
651-707 (57) TSSHLPSSPAAGDCPILATPESPPPLAPETPDEAASVAADSDVQVPGPAASPKPLGR PA
1
720-740 (21) LPGARPDAGMGPPSAVAERPK PA
1
741-772 (32) VSLHFDTETDGYFSDGEMSDSDVEAEDGGVQR PA
1
776-784 (9) EAGAEEVVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center