Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NQT4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MEEETHTDAK PA
0
13-22 (10) AENGTGSSPR PA
0
30-65 (36) HFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVK PA
0
74-83 (10) ATLEVILRPK PA
0
84-92 (9) IGLPGVAEK PA
0
100-113 (14) NTCEAVVLGTLHPR PA
0
114-149 (36) TSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMR PA
0
150-172 (23) ALFCGVACALDSDGTLVLDPTSK PA
0
179-190 (12) AVLTFALDSVER PA
0
199-222 (24) GLYSDTELQQCLAAAQAASQHVFR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center