Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NRA8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-19 (15) SMGETESGDAFLDLK PA
2
46-54 (9) QRPSCLSEK PA
2
55-65 (11) YDSDGVWDPEK PA
2
66-76 (11) WHASLYPASGR PA
2
77-84 (8) SSPVESLK PA
2
86-96 (11) ELDTDRPSLVR PA
2
107-118 (12) EDDLDVVLSPQR PA
1
120-134 (15) SFGGGCHVTAAVSSR PA
1
211-241 (31) NDSYTEEEPEWFSAGPTSQSETIELTGFDDK PA
1
262-293 (32) EGIVECNGGVAEEDEVEVILAQEPAADQEVPR PA
1
294-315 (22) DAVLPEQSPGDFDFNEFFNLDK PA
2
316-336 (21) VPCLASMIEDVLGEGSVSASR PA
2
351-364 (14) SSSLGSTPHEELER PA
2
365-395 (31) LAGLEQAILSPGQNSGNYFAPIPLEDHAENK PA
2
396-404 (9) VDILEMLQK PA
2
407-420 (14) VDLKPLLSSLSANK PA
2
425-443 (19) ESSHSGVVLSVEEVEAGLK PA
2
453-473 (21) NSTPFMAEHLEETLSAVTNNR PA
2
478-486 (9) DGDMTAFNK PA
2
493-502 (10) ASGTLPSQPK PA
1
506-524 (19) NLESHLMSPAEIPGQPVPK PA
2
525-561 (37) NILQELLGQPVQRPASSNLLSGLMGSLEPTTSLLGQR PA
2
562-574 (13) APSPPLSQVFQTR PA
2
575-584 (10) AASADYLRPR PA
2
585-607 (23) IPSPIGFTPGPQQLLGDPFQGMR PA
2
608-655 (48) KPMSPITAQMSQLELQQAALEGLALPHDLAVQAANFYQPGFGKPQVDR PA
0
677-703 (27) GNSSSPAPAASITSMLSPSFTPTSVIR PA
2
733-749 (17) ASEENLLSSSSVPSADR PA
2
750-758 (9) DSSPTTNSK PA
2
765-776 (12) SSCSTPLSQANR PA
2
792-833 (42) TPTLASPVPTTPFLRPVHQVPLVPHVPMVRPAHQLHPGLVQR PA
2
834-904 (71) MLAQGVHPQHLPSLLQTGVLPPGMDLSHLQGISGPILGQPFYPLPAASHPLLNPRPGTPLHLAMVQQQLQR PA
2
905-931 (27) SVLHPPGSGSHAAAVSVQTTPQNVPSR PA
2
932-948 (17) SGLPHMHSQLEHRPSQR PA
2
949-957 (9) SSSPVGLAK PA
2
958-974 (17) WFGSDVLQQPLPSMPAK PA
2
975-984 (10) VISVDELEYR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center