Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NRA8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-19 (15) SMGETESGDAFLDLK PA
2
46-54 (9) QRPSCLSEK PA
2
55-65 (11) YDSDGVWDPEK PA
2
66-76 (11) WHASLYPASGR PA
2
77-84 (8) SSPVESLK PA
2
86-96 (11) ELDTDRPSLVR PA
2
98-130 (33) IVGIVECNGGVAEEDEVEVILAQEPAADQEVPR PA
0
131-152 (22) DAVLPEQSPGDFDFNEFFNLDK PA
2
153-173 (21) VPCLASMIEDVLGEGSVSASR PA
2
188-201 (14) SSSLGSTPHEELER PA
2
202-232 (31) LAGLEQAILSPGQNSGNYFAPIPLEDHAENK PA
2
233-241 (9) VDILEMLQK PA
2
244-257 (14) VDLKPLLSSLSANK PA
2
262-280 (19) ESSHSGVVLSVEEVEAGLK PA
2
290-310 (21) NSTPFMAEHLEETLSAVTNNR PA
2
315-323 (9) DGDMTAFNK PA
2
331-349 (19) NLESHLMSPAEIPGQPVPK PA
2
350-386 (37) NILQELLGQPVQRPASSNLLSGLMGSLEPTTSLLGQR PA
2
387-399 (13) APSPPLSQVFQTR PA
2
400-409 (10) AASADYLRPR PA
2
410-432 (23) IPSPIGFTPGPQQLLGDPFQGMR PA
2
433-481 (49) KPMSPITAQQMSQLELQQAALEGLALPHDLAVQAANFYQPGFGKPQVDR PA
1
503-529 (27) GNSSSPAPAASITSMLSPSFTPTSVIR PA
2
559-575 (17) ASEENLLSSSSVPSADR PA
2
576-584 (9) DSSPTTNSK PA
2
591-602 (12) SSCSTPLSQANR PA
2
618-659 (42) TPTLASPVPTTPFLRPVHQVPLVPHVPMVRPAHQLHPGLVQR PA
2
660-730 (71) MLAQGVHPQHLPSLLQTGVLPPGMDLSHLQGISGPILGQPFYPLPAASHPLLNPRPGTPLHLAMVQQQLQR PA
2
731-757 (27) SVLHPPGSGSHAAAVSVQTTPQNVPSR PA
2
758-774 (17) SGLPHMHSQLEHRPSQR PA
2
775-783 (9) SSSPVGLAK PA
2
784-800 (17) WFGSDVLQQPLPSMPAK PA
2
801-810 (10) VISVDELEYR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center