Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NU02-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-15 (8) LENLQIYK PA
0
34-79 (46) LGYPELINYTEPINGLSALHLASVSNDIDMVSFLLDLGAHPDVQDR PA
0
80-87 (8) MGCTPTMR PA
0
88-102 (15) AAELGHELSMEILAK PA
0
105-115 (11) ADMTIVDNEGK PA
0
116-126 (11) GVLFYCILPTK PA
0
131-155 (25) CALIALEHGADVNNSTYEGKPIFLR PA
0
156-164 (9) ACEDAHDVK PA
0
165-173 (9) DVCLTFLEK PA
0
174-186 (13) GANPNAINSSTGR PA
0
187-194 (8) TALMEASR PA
0
195-202 (8) EGVVEIVR PA
0
208-218 (11) GGEVNAFDNDR PA
0
219-227 (9) HHAAHFAAK PA
0
228-235 (8) GGFFDILK PA
0
236-268 (33) LLFAYNGDVGLISINGNTPLHYAAMGGFADCCK PA
0
320-328 (9) NPNPLWALR PA
0
329-336 (8) LHDWSVER PA
0
342-349 (8) EAFAVLDR PA
0
357-366 (10) NDFVMVLEER PA
0
367-384 (18) QDYASSEQLAAIAHLHEK PA
0
387-397 (11) GGGVNINEFFK PA
0
405-414 (10) SFVLGSYGPK PA
0
429-445 (17) FVLPLPICVIPEYAFPR PA
0
447-460 (14) QDGGPPYYMIETYK PA
0
471-491 (21) DHPPEHPIQDDSVWYIDDSEK PA
0
492-501 (10) VFSNINIITK PA
0
502-509 (8) AGDLASLK PA
0
511-521 (11) AFESGIPVDMK PA
0
527-542 (16) TPLMTACASGNIDVVK PA
0
548-597 (50) GANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNR PA
0
609-616 (8) YLLDIGAK PA
0
624-632 (9) GHSAMDVAK PA
0
647-658 (12) LDNLPKPAENQK PA
0
677-694 (18) EEELLSSIYGVPTTSEGK PA
0
699-714 (16) GNVVHLNSLITSGYTK PA
0
716-723 (8) VDITFIPR PA
0
725-737 (13) IWSPEATTAELIR PA
0
746-761 (16) FTHEVDFDDFMMPFQK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center