Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NUB4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-12 (9) LCLPRPEAR PA
0
13-21 (9) EDPIPVPPR PA
0
22-96 (75) GLGAGEGSGSPVRPPVSTWGPSWAQLLDSVLWLGALGLTIQAVFSTTGPALLLLLVSFLTFDLLHRPAGHTLPQR PA
0
102-146 (45) GQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLLR PA
0
147-165 (19) ACGMPLTLLGLAFCLHPWA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center