Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NW38-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAVTEASLLR PA
1
11-20 (10) QCPLLLPQNR PA
1
23-34 (12) TVYEGFISAQGR PA
1
40-49 (10) IVLPEDLQLK PA
1
53-60 (8) LLCSWQLR PA
1
61-68 (8) TILSGYHR PA
1
74-88 (15) MQHSPDLMSFMMELK PA
1
89-96 (8) MLLEVALK PA
1
99-125 (27) QELYALPPPPQFYSSLIEEIGTLGWDK PA
1
126-137 (12) LVYADTCFSTIK PA
1
158-198 (41) YPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLK PA
0
199-210 (12) AFWDVMDEIDEK PA
1
211-221 (11) TWVLEPEKPPR PA
1
228-243 (16) IALGNNVSINIEVDPR PA
1
244-266 (23) HPTMLPECFFLGADHVVKPLGIK PA
1
270-285 (16) NIHLWDPENSVLQNLK PA
1
286-295 (10) DVLEIDFPAR PA
1
301-343 (43) SDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLR PA
1
350-369 (20) QSFNIIFGECPYCSKPITLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center