Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NX40-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-32 (24) EPNAEVPRPIPHIGPDYIPTEEER PA
3
34-46 (13) VFAECNDESFWFR PA
3
47-64 (18) SVPLAATSMLITQGLISK PA
3
65-72 (8) GILSSHPK PA
3
79-91 (13) LILACIMGYFAGK PA
3
105-115 (11) LENSPLGEALR PA
3
122-131 (10) SSPPGHYYQK PA
3
134-184 (51) YDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center