Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9NZN8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-12 (9) TDGHTLSEK PA
2
14-26 (13) NYQVTNSMFGASR PA
2
29-53 (25) FVEGVDSDYHDENMYYSQSSMFPHR PA
2
57-87 (31) DMLASPSTSGQLSQFGASLYGQQSALGLPMR PA
2
88-98 (11) GMSNNTPQLNR PA
2
99-129 (31) SLSQGTQLPSHVTPTTGVPTMSLHTPPSPSR PA
2
130-137 (8) GILPMNPR PA
2
138-154 (17) NMMNHSQVGQGIGIPSR PA
2
155-168 (14) TNSMSSSGLGSPNR PA
2
169-178 (10) SSPSIICMPK PA
2
184-198 (15) QPFTVNSMSGFGMNR PA
3
199-236 (38) NQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADR PA
2
240-255 (16) EGSGNPTPLINPLAGR PA
2
256-289 (34) APYVGMVTKPANEQSQDFSIHNEDFPALPGSSYK PA
2
290-299 (10) DPTSSNDDSK PA
3
300-307 (8) SNLNTSGK PA
3
308-316 (9) TTSSTDGPK PA
3
322-332 (11) SSTTQNNNQQK PA
3
334-342 (9) GIQVLPDGR PA
3
343-365 (23) VTNIPQGMVTDQFGMIGLLTFIR PA
3
366-398 (33) AAETDPGMVHLALGSDLTTLGLNLNSPENLYPK PA
4
399-428 (30) FASPWASSPCRPQDIDFHVPSEYLTNIHIR PA
4
439-467 (29) YGEDLLFYLYYMNGGDVLQLLAAVELFNR PA
3
482-490 (9) APGMEPTMK PA
3
497-508 (12) GTYYFFDCLNWR PA
3
513-520 (8) EFHLEYDK PA
3
521-540 (20) LEERPHLPSTFNYNPAQQAF PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center