Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P055-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-16 (9) SADLALLEK PA
0
17-31 (15) NLQAAHGCLGLYCGK PA
0
37-51 (15) NGSTEIYGECGVCPR PA
3
60-97 (38) YCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGK PA
3
99-133 (35) SSSALFQHITALFECSMAAIITLLVSDPVGVLYIR PA
4
137-192 (56) VLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVK PA
4
206-262 (57) SIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVR PA
4
266-285 (20) LIVLFSHWLLHAYGIISISR PA
4
289-311 (23) LEQDLPLLALVPTPALFYLFTAK PA
4
318-326 (9) ILSEGANGH PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center